PSMC6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13822

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: VGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PSMC6 Antibody - BSA Free

Western Blot: PSMC6 Antibody [NBP2-13822]

Western Blot: PSMC6 Antibody [NBP2-13822]

Western Blot: PSMC6 Antibody [NBP2-13822] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: PSMC6 Antibody [NBP2-13822]

Immunocytochemistry/ Immunofluorescence: PSMC6 Antibody [NBP2-13822]

Immunocytochemistry/Immunofluorescence: PSMC6 Antibody [NBP2-13822] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: PSMC6 Antibody [NBP2-13822]

Immunohistochemistry-Paraffin: PSMC6 Antibody [NBP2-13822]

Immunohistochemistry-Paraffin: PSMC6 Antibody [NBP2-13822] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells of seminiferus ducts.

Applications for PSMC6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSMC6

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12.

Alternate Names

26S protease regulatory subunit 10B, 26S protease regulatory subunit S10B, 26S proteasome AAA-ATPase subunit RPT4, CADP44, conserved ATPase domain protein 44, MGC12520, p42, P44, proteasome (prosome, macropain) 26S subunit, ATPase, 6, Proteasome 26S subunit ATPase 6, Proteasome subunit p42, SUG2

Gene Symbol

PSMC6

Additional PSMC6 Products

Product Documents for PSMC6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSMC6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PSMC6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSMC6 Antibody - BSA Free and earn rewards!

Have you used PSMC6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...