PSMF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80910

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LVCFLHWEVVTHGYCGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PSMF1 Antibody - BSA Free

Western Blot: PSMF1 Antibody [NBP1-80910]

Western Blot: PSMF1 Antibody [NBP1-80910]

Western Blot: PSMF1 Antibody [NBP1-80910] - Analysis in control (vector only transfected HEK293T lysate) and PSMF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: PSMF1 Antibody [NBP1-80910]

Immunocytochemistry/ Immunofluorescence: PSMF1 Antibody [NBP1-80910]

Immunocytochemistry/Immunofluorescence: PSMF1 Antibody [NBP1-80910] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: PSMF1 Antibody [NBP1-80910]

Immunohistochemistry-Paraffin: PSMF1 Antibody [NBP1-80910]

Immunohistochemistry-Paraffin: PSMF1 Antibody [NBP1-80910] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Applications for PSMF1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSMF1

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a protein that inhibits the activation of the proteasome by the 11S and 19S regulators. Alternative transcript variants have been identified for this gene.

Alternate Names

hPI31, PI31, proteasome (prosome, macropain) inhibitor subunit 1 (PI31), proteasome inhibitor hP131 subunit, proteasome inhibitor PI31 subunit

Entrez Gene IDs

9491 (Human)

Gene Symbol

PSMF1

UniProt

Additional PSMF1 Products

Product Documents for PSMF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSMF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PSMF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSMF1 Antibody - BSA Free and earn rewards!

Have you used PSMF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...