PTGER3 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-84835PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTGER3.

Source: E. coli

Amino Acid Sequence: MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84835.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-84835PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PTGER3

Prostaglandin E Receptor EP3 is a member of the G protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Prostaglandin E2 Receptor EP3 expression has been documented throughout the periphery, especially kidney. ESTs have been isolated primarily from kidney libraries.

Long Name

Prostaglandin E2 Receptor 3, Subtype EP3

Alternate Names

EP3

Gene Symbol

PTGER3

Additional PTGER3 Products

Product Documents for PTGER3 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PTGER3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for PTGER3 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review PTGER3 Recombinant Protein Antigen and earn rewards!

Have you used PTGER3 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for PTGER3 Recombinant Protein Antigen

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I received an e-mail about some complimentary antibody samples that are available. We work with Ptger3 and have tried several antibodies (Santa Cruz, Abcam, Cayman) but haven't found an antibody that works. I was wondering if you would be willing to send us a complimentary sample of your Ptger3 antibody to test? If it works, we will likely buy a decent amount.

    A:

    A list of our Ptger3 antibodies can be found here. It is company policy that we do not give out free samples as we have a 100% guarantee on all of our products for the applications and species listed on the datasheet. The email you received about free samples only applies to the antibodies listed in the email, of which Ptger3 is not listed.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...