PTGFR Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82318

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PTGFR Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTGFR. Peptide sequence: RFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQGRSHHLEMV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PTGFR Antibody - BSA Free

Western Blot: PTGFR Antibody [NBP2-82318]

Western Blot: PTGFR Antibody [NBP2-82318]

Western Blot: PTGFR Antibody [NBP2-82318] - Host: Rabbit. Target Name: PTGFR. Sample Type: Human 721_B. Antibody Dilution: 1.0ug/mlPTGFR is supported by BioGPS gene expression data to be expressed in 721_B
Western Blot: PTGFR Antibody [NBP2-82318]

Western Blot: PTGFR Antibody [NBP2-82318]

Western Blot: PTGFR Antibody [NBP2-82318] - WB Suggested Anti-PTGFR Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal kidney

Applications for PTGFR Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTGFR

The prostaglandin F2-alpha receptor is a member of the Prostanoid Receptor subfamily. Along with various other prostaglandin receptors, it mediates the effects of prostaglandin F(2-alpha) which include modulation of intraocular pressure, corpus luteum regression, and possibly uterine smooth muscle contraction. Alternative mRNA splicing gives rise to two isoforms, FP(A) and FP(B), that differ in their intracellular carboxyl termini and result in different mechanisms for receptor internalization. Prostaglandin F2-alpha receptor expression has been documented in eye, ovary, placenta, and uterus. ESTs have been isolated from placental libraries.

Long Name

Prostaglandin F Receptor

Alternate Names

FP, PGF2-alpha Receptor

Gene Symbol

PTGFR

Additional PTGFR Products

Product Documents for PTGFR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PTGFR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PTGFR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PTGFR Antibody - BSA Free and earn rewards!

Have you used PTGFR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies