PTH Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55612

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PTH Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PTH Antibody - BSA Free

Immunohistochemistry-Paraffin: PTH Antibody [NBP2-55612]

Immunohistochemistry-Paraffin: PTH Antibody [NBP2-55612]

Immunohistochemistry-Paraffin: PTH Antibody [NBP2-55612] - Analysis in human parathyroid gland and liver tissues using NBP2-55612 antibody. Corresponding PTH RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PTH Antibody [NBP2-55612]

Immunohistochemistry-Paraffin: PTH Antibody [NBP2-55612]

Immunohistochemistry-Paraffin: PTH Antibody [NBP2-55612] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: PTH Antibody [NBP2-55612]

Immunohistochemistry-Paraffin: PTH Antibody [NBP2-55612]

Immunohistochemistry-Paraffin: PTH Antibody [NBP2-55612] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: PTH Antibody [NBP2-55612]

Immunohistochemistry-Paraffin: PTH Antibody [NBP2-55612]

Immunohistochemistry-Paraffin: PTH Antibody [NBP2-55612] - Staining of human parathyroid gland shows moderate granular cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: PTH Antibody [NBP2-55612]

Immunohistochemistry-Paraffin: PTH Antibody [NBP2-55612]

Immunohistochemistry-Paraffin: PTH Antibody [NBP2-55612] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for PTH Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTH

Parathyroid hormone (PTH), which is also designated parathyrin, is an 84 amino acid single chain peptide that functions to regulate calcium metabolism by raising blood levels of calcium through various mechanisms. PTH stimulates bone formation to increase bone mass and strength in rats and humans. Within the PTH molecule, the essential activity is associated with the first 34 amino acids at the amino-terminus of the molecule. The gene encoding PTH maps to human chromosome 11p15.3-p15.1. Parathyroid hormone-related protein (PTH-rP) is an autocrine factor that is structurally related to PTH yet, unlike PTH, which is synthesized only by the parathyroid cells, PTH-rP is synthesized by several cell types. PTH-rP regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Isolated from the culture medium of a human lung cancer cell line, PTH-rP produces PTH-like effects that are characterized as humoral hypercalcemia of malignancy.

Long Name

Parathyroid Hormone

Alternate Names

Parathormone, Parathyrin

Gene Symbol

PTH

Additional PTH Products

Product Documents for PTH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PTH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PTH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PTH Antibody - BSA Free and earn rewards!

Have you used PTH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies