PTPN14/PTPD2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38712

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PTPN14 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARVLRHGPAKAISMSRTD

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PTPN14/PTPD2 Antibody - BSA Free

Western Blot: PTPN14/PTPD2 Antibody [NBP2-38712]

Western Blot: PTPN14/PTPD2 Antibody [NBP2-38712]

Western Blot: PTPN14/PTPD2 Antibody [NBP2-38712] - Analysis in human cell lines U-251MG and MCF-7 using anti-PTPN14 antibody. Corresponding PTPN14 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: PTPN14/PTPD2 Antibody [NBP2-38712]

Immunocytochemistry/ Immunofluorescence: PTPN14/PTPD2 Antibody [NBP2-38712]

Immunocytochemistry/Immunofluorescence: PTPN14/PTPD2 Antibody [NBP2-38712] - Staining of human cell line HeLa shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PTPN14/PTPD2 Antibody [NBP2-38712]

Immunohistochemistry-Paraffin: PTPN14/PTPD2 Antibody [NBP2-38712]

Immunohistochemistry-Paraffin: PTPN14/PTPD2 Antibody [NBP2-38712] - Staining of human prostate shows weak cytoplasmic positivity in smooth muscle cells.

Applications for PTPN14/PTPD2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTPN14

PTPD2 is a member of the protein tyrosine phosphatase (PTP) family. The PTPs have high substrate specificity for phosphotyrosyl proteins and, at the primary sequence level, share little similarity with the protein serine phosphatases, protein threonine phosphatases, or the acid and alkaline phosphatases. This PTP contains an N-terminal noncatalytic domain similar to that of band 4.1 superfamily cytoskeleton-associated proteins, which suggested the membrane or cytoskeleton localization of this protein. The specific function of this PTP has not yet been determined, although there is evidence to suggest that PTPD2 is involved in regulating cell proliferation.

Long Name

Protein Tyrosine Phosphatase Non-receptor Type 14

Alternate Names

PEZ

Gene Symbol

PTPN14

UniProt

Q15678 (Human)

Additional PTPN14 Products

Product Documents for PTPN14/PTPD2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PTPN14/PTPD2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Epigenetics
Phosphatases and Regulators

Customer Reviews for PTPN14/PTPD2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PTPN14/PTPD2 Antibody - BSA Free and earn rewards!

Have you used PTPN14/PTPD2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies