PTPRD Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-94767
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse
Cited:
Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA
Cited:
Immunohistochemistry, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 475-574 of human PTPRD (NP_002830.1). QITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGEEQRITIEPGTSYRLQG
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
215 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for PTPRD Antibody - BSA Free
Immunohistochemistry: PTPRD Antibody [NBP2-94767] -
nbp2-94767_rabbit-polyclonal-ptprd-antibody-2552023153955.jpgWestern Blot: PTPRD Antibody [NBP2-94767] -
Western Blot: PTPRD Antibody [NBP2-94767] - Analysis of various lysates, using PTPRD Rabbit pAb at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.Immunohistochemistry: PTPRD Antibody - BSA Free [NBP2-94767] -
Immunohistochemistry: PTPRD Antibody - BSA Free [NBP2-94767] - Protein tyrosine phosphatase receptor type D expression levels are increased in the DRG after CCI. (A) Representative images of DRG sections stained for PTPRD (red) & Tuj1 (green) in the indicated groups. Scale bars, 100 μm. (B) Western blot of PTPRD levels in ipsilateral DRGs (L4–L5) at 0, 1, 3, 7, & 14 days after CCI. Each experiment was repeated three times. (C) Quantitative analysis of data in (B). N = 3, **p < 0.01, ***p < 0.001. (D) Western blot of PTPRD levels in contralateral DRGs (L4–L5) at 0, 1, 3, 7, & 14 days after CCI. Each experiment was repeated three times. (E) Quantitative analysis of data in (D). N = 3, p > 0.05. Statistical comparisons were performed by unpaired Student’s t-test (C,E). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35493326), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: PTPRD Antibody - BSA Free [NBP2-94767] -
Protein tyrosine phosphatase receptor type D knockdown attenuates neuropathic pain following CCI. (A) Representative images of GFP (green) and NeuN staining (red) 14 days after shPTPRD injection in the DRG. Scale bar, 100 μm. (B) qRT-PCR analysis of the relative expression of PTPRD in DRGs transfected with shCtrl or shPTPRD after CCI. N = 3, ***p < 0.001. (C) Western blot of PTPRD in DRG tissues transfected with shCtrl or shPTPRD after CCI. Each experiment was repeated three times. (D) Quantitative analysis of data in (C). GAPDH served as the loading control. N = 3, ***p < 0.001. (E) Schedule of lentivirus administration, surgery, and behavioral testing. (F–H) Paw withdrawal threshold, paw withdrawal latency, and paw withdrawal frequency prior to virus injection (BL), on the day of surgery, or 1, 3, 5, 7, 14, and 21 days after CCI. N = 6 mice per group. CCI + shPTPRD vs. CCI + shCtrl, *p < 0.05, **p < 0.01, ***p < 0.001. CCI vs. sham, #p < 0.05, ##p < 0.01, ###p < 0.001. Statistical comparisons were performed using unpaired Student’s t-test (B,D) or two-way ANOVA with Tukey’s post hoc test (F–H). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35493326), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for PTPRD Antibody - BSA Free
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL
Immunohistochemistry
1:100-1:200
Western Blot
1:500-1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: PTPRD
Long Name
Protein Tyrosine Phosphatase Receptor-type delta
Alternate Names
PTP delta, PTP-delta, PTPD, PTPdelta, R-PTP-Delta, RPTP-Delta
Gene Symbol
PTPRD
Additional PTPRD Products
Product Documents for PTPRD Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PTPRD Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for PTPRD Antibody - BSA Free
Customer Reviews for PTPRD Antibody - BSA Free
There are currently no reviews for this product. Be the first to review PTPRD Antibody - BSA Free and earn rewards!
Have you used PTPRD Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...