PTPRD Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94767

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Cited:

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 475-574 of human PTPRD (NP_002830.1). QITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGEEQRITIEPGTSYRLQG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

215 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit PTPRD Antibody - BSA Free (NBP2-94767) is a polyclonal antibody validated for use in IHC, WB and ELISA. Anti-PTPRD Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PTPRD Antibody - BSA Free

PTPRD Antibody

Immunohistochemistry: PTPRD Antibody [NBP2-94767] -

nbp2-94767_rabbit-polyclonal-ptprd-antibody-2552023153955.jpg
PTPRD Antibody

Western Blot: PTPRD Antibody [NBP2-94767] -

Western Blot: PTPRD Antibody [NBP2-94767] - Analysis of various lysates, using PTPRD Rabbit pAb at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
PTPRD Antibody - BSA Free

Immunohistochemistry: PTPRD Antibody - BSA Free [NBP2-94767] -

Immunohistochemistry: PTPRD Antibody - BSA Free [NBP2-94767] - Protein tyrosine phosphatase receptor type D expression levels are increased in the DRG after CCI. (A) Representative images of DRG sections stained for PTPRD (red) & Tuj1 (green) in the indicated groups. Scale bars, 100 μm. (B) Western blot of PTPRD levels in ipsilateral DRGs (L4–L5) at 0, 1, 3, 7, & 14 days after CCI. Each experiment was repeated three times. (C) Quantitative analysis of data in (B). N = 3, **p < 0.01, ***p < 0.001. (D) Western blot of PTPRD levels in contralateral DRGs (L4–L5) at 0, 1, 3, 7, & 14 days after CCI. Each experiment was repeated three times. (E) Quantitative analysis of data in (D). N = 3, p > 0.05. Statistical comparisons were performed by unpaired Student’s t-test (C,E). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35493326), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
PTPRD Antibody - BSA Free

Western Blot: PTPRD Antibody - BSA Free [NBP2-94767] -

Protein tyrosine phosphatase receptor type D knockdown attenuates neuropathic pain following CCI. (A) Representative images of GFP (green) and NeuN staining (red) 14 days after shPTPRD injection in the DRG. Scale bar, 100 μm. (B) qRT-PCR analysis of the relative expression of PTPRD in DRGs transfected with shCtrl or shPTPRD after CCI. N = 3, ***p < 0.001. (C) Western blot of PTPRD in DRG tissues transfected with shCtrl or shPTPRD after CCI. Each experiment was repeated three times. (D) Quantitative analysis of data in (C). GAPDH served as the loading control. N = 3, ***p < 0.001. (E) Schedule of lentivirus administration, surgery, and behavioral testing. (F–H) Paw withdrawal threshold, paw withdrawal latency, and paw withdrawal frequency prior to virus injection (BL), on the day of surgery, or 1, 3, 5, 7, 14, and 21 days after CCI. N = 6 mice per group. CCI + shPTPRD vs. CCI + shCtrl, *p < 0.05, **p < 0.01, ***p < 0.001. CCI vs. sham, #p < 0.05, ##p < 0.01, ###p < 0.001. Statistical comparisons were performed using unpaired Student’s t-test (B,D) or two-way ANOVA with Tukey’s post hoc test (F–H). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35493326), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for PTPRD Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunohistochemistry

1:100-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PTPRD

The protein encoded by the PTPRD gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular region, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, thus represents a receptor-type PTP. The extracellular region of this protein is composed of three Ig-like and eight fibronectin type III-like domains. Studies of the similar genes in chick and fly suggest the role of this PTP is in promoting neurite growth, and regulating neurons axon guidance. Multiple tissue specific alternatively spliced transcript variants of this gene have been reported. (provided by RefSeq)

Long Name

Protein Tyrosine Phosphatase Receptor-type delta

Alternate Names

PTP delta, PTP-delta, PTPD, PTPdelta, R-PTP-Delta, RPTP-Delta

Gene Symbol

PTPRD

Additional PTPRD Products

Product Documents for PTPRD Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PTPRD Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for PTPRD Antibody - BSA Free

Customer Reviews for PTPRD Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PTPRD Antibody - BSA Free and earn rewards!

Have you used PTPRD Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...