Puratrophin-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56984

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Puratrophin-1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MGVGNKAFRDIAPSEEAINDRTVNYVLKCREVRSRASIAVAPFDHDSLYLGASNSLPGDPASCSVLGSLNLHLYRDPALLGLRCPLYPSFP

Reactivity Notes

Rat 80%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Puratrophin-1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Puratrophin-1 Antibody [NBP2-56984]

Immunocytochemistry/ Immunofluorescence: Puratrophin-1 Antibody [NBP2-56984]

Immunocytochemistry/Immunofluorescence: Puratrophin-1 Antibody [NBP2-56984] - Staining of human cell line CACO-2 shows localization to cell junctions.

Applications for Puratrophin-1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Puratrophin-1

PLEKHG4 is encoded by this gene contains multiple domains suggestive of a role in intracellular signaling and cytoskeleton dynamics at the Golgi apparatus. Mutations in this gene are associated with spinocerebellar ataxia 16q22-linked. Several alternatively spliced transcript variants, differing only in the 5' UTR, or encoding a different isoform, have been found for this gene.

Alternate Names

ARHGEF44, DKFZP434I216, PH domain-containing family G member 4, pleckstrin homology domain containing, family G (with RhoGef domain) member 4, Pleckstrin homology domain-containing family G member 4, PRTPHN1, puratrophin-1, Purkinje cell atrophy associated protein 1, Purkinje cell atrophy-associated protein 1, SCA4, spinocerebellar ataxia 4

Gene Symbol

PLEKHG4

Additional Puratrophin-1 Products

Product Documents for Puratrophin-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Puratrophin-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Puratrophin-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Puratrophin-1 Antibody - BSA Free and earn rewards!

Have you used Puratrophin-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies