RAB1B Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37965

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 7-201 of human RAB1B (NP_112243.1).

Sequence:
YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RAB1B Antibody - BSA Free

RAB1B Antibody

Immunocytochemistry/ Immunofluorescence: RAB1B Antibody [NBP3-37965] -

Immunocytochemistry/ Immunofluorescence: RAB1B Antibody [NBP3-37965] - Immunofluorescence analysis of C6 cells using RAB1B Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
RAB1B Antibody

Immunocytochemistry/ Immunofluorescence: RAB1B Antibody [NBP3-37965] -

Immunocytochemistry/ Immunofluorescence: RAB1B Antibody [NBP3-37965] - Immunofluorescence analysis of U-2 OS cells using RAB1B Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
RAB1B Antibody

Immunocytochemistry/ Immunofluorescence: RAB1B Antibody [NBP3-37965] -

Immunocytochemistry/ Immunofluorescence: RAB1B Antibody [NBP3-37965] - Immunofluorescence analysis of NIH-3T3 cells using RAB1B Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
RAB1B Antibody

Western Blot: RAB1B Antibody [NBP3-37965] -

Western Blot: RAB1B Antibody [NBP3-37965] - Western blot analysis of various lysates using RAB1B Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for RAB1B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RAB1B

Members of the RAB protein family, such as RAB1B, are low molecular mass monomeric GTPases localized on the cytoplasmicsurfaces of distinct membrane-bound organelles. RAB1B functions in the early secretory pathway and is essential forvesicle transport between the endoplasmic reticulum (ER) and Golgi (Chen et al., 1997 (PubMed 9030196); Alvarez etal., 2003 (PubMed 12802079)).(supplied by OMIM)

Alternate Names

RAB1B, member RAS oncogene family, ras-related protein Rab-1B, small GTP-binding protein

Gene Symbol

RAB1B

Additional RAB1B Products

Product Documents for RAB1B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAB1B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB1B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB1B Antibody - BSA Free and earn rewards!

Have you used RAB1B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...