RAB26 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35676

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RAB26 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human RAB26 (NP_055168.2).

Sequence:
MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RAB26 Antibody - BSA Free

RAB26 Antibody

Western Blot: RAB26 Antibody [NBP3-35676] -

Western Blot: RAB26 Antibody [NBP3-35676] - Western blot analysis of various lysates using RAB26 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for RAB26 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RAB26

RAB26 belongs to the RAB family of proteins which are involved regulation of vesicular trafficking. RAB26 is involved in several biological processes including exocrine system development, protein transport, regulation of exocytosis and transport. RAB26 is known to have interactions with GCH1, RPH3AL, RIMS1, RPH3A and PCSK6. Studies of RAB26 have been conducted in relation to carcinoma, neuronitis and transitional cell carcinoma.

Alternate Names

RAB26, member RAS oncogene family, Ras-related oncogene protein, ras-related protein Rab-26, V46133

Gene Symbol

RAB26

Additional RAB26 Products

Product Documents for RAB26 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RAB26 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB26 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB26 Antibody - BSA Free and earn rewards!

Have you used RAB26 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies