RAB5C Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-80858
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human, Mouse
Cited:
Human, Mouse
Predicted:
Rat (97%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Western Blot
Cited:
Western Blot, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
Reactivity Notes
Mouse reported in ( PMID: 32096265).
Marker
Early Endosome Marker
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for RAB5C Antibody - BSA Free
Western Blot: RAB5C Antibody [NBP1-80858]
Western Blot: RAB5C Antibody [NBP1-80858] - Human cancer cell line lysates PC-3, LOVO and SK-BR-3. Image from verified customer review.Applications for RAB5C Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
Reported in (PMID: 24802056)
Western Blot
0.04-0.4 ug/ml
Reviewed Applications
Read 2 reviews rated 4.5 using NBP1-80858 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RAB5C
Alternate Names
L1880, MGC117217, RAB5C, member of RAS oncogene family, RAB5C, member RAS oncogene family, RAB5CL, RAB5L, RABLMGC138857, ras-related protein Rab-5C
Entrez Gene IDs
5878 (Human)
Gene Symbol
RAB5C
UniProt
Additional RAB5C Products
Product Documents for RAB5C Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RAB5C Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RAB5C Antibody - BSA Free
Customer Reviews for RAB5C Antibody - BSA Free (2)
4.5 out of 5
2 Customer Ratings
Have you used RAB5C Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
2 of
2 reviews
Showing All
Filter By:
-
Application: Western BlotSample Tested: AGS human gastric adenocarcinoma cell lineSpecies: HumanVerified Customer | Posted 11/18/2019Several bands between 25-37 kd can be detected in AGS cell lysates (Green). Specificity needs to be clarified using overexpression experiments for this antibody.
-
Application: Western BlotSample Tested: 3 human cancer cell linesSpecies: HumanVerified Customer | Posted 07/18/2018Total cell lysates from PC-3, LOVO and SK-BR-3 were subjected to western blot. PVDF membrane were probed with 0.5 um/ml RAB5C Antibody (NBP1-80858). A specific band was detected for RAB5C at approximately 25 kDa. This experiment was conducted under reducing conditions
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...