Rabphilin 3A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38317

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Rabphilin 3A Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Rabphilin 3A (NP_055769.2).

Sequence:
MTDTVFSNSSNRWMYPSDRPLQSKLQAGWSVHPGGQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKKNVCTKCGVETNNRLHSVWLCKICIEQREVWKRSGAWFFKGFPKQVLPQPMPIKKTKPQQPVSEPAAPEQPAPEPKHPARAPARGDSEDRRGPGQKTGPDPASAPGRGNYGPPVRRASEARMSSSSRDSESWDHSGGAGDSSRSPAGLRRANSVQASRPAPGSVQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Rabphilin 3A Antibody - BSA Free

Rabphilin 3A Antibody

Western Blot: Rabphilin 3A Antibody [NBP3-38317] -

Western Blot: Rabphilin 3A Antibody [NBP3-38317] - Western blot analysis of various lysates using Rabphilin 3A Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for Rabphilin 3A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Rabphilin 3A

Rabphilin-3A is a peripheral membrane protein that binds Ca2+ and phospholipids and is attached to synaptic vesicle membranes (Geppert et al., 1994; Li et al., 1994). The expression of rabphilin 3A is reduced in an animal model of Huntington's disease (Smith et al., 2005). Rabphilin can be phosphorylated at Ser234 by both CAM kinase II and PKA and this phosphorylation has been suggested to regulate neuronal activity during development in a synapse-specific manner (Fykse et al., 1995; Foletti and Scheller, 2001).

Alternate Names

Exophilin-1, KIAA0985exophilin-1, rabphilin, rabphilin 3A homolog (mouse), rabphilin-3A

Gene Symbol

RPH3A

Additional Rabphilin 3A Products

Product Documents for Rabphilin 3A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Rabphilin 3A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rabphilin 3A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Rabphilin 3A Antibody - BSA Free and earn rewards!

Have you used Rabphilin 3A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies