RAGEF2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35727

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RAGEF2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 145-240 of human RAGEF2 (NP_001157858).

Sequence:
INYKGERQTITDDVEVNSYLSLPADLTKMHLTENPHPQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDDEEEDEEI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

179 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RAGEF2 Antibody - BSA Free

RAGEF2 Antibody

Western Blot: RAGEF2 Antibody [NBP3-35727] -

Western Blot: RAGEF2 Antibody [NBP3-35727] - Western blot analysis of various lysates using RAGEF2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for RAGEF2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RAGEF2

Low similarity to human CAMP-GEFII; may be a membrane signalling protein; contains a PDZ, a cyclic nucleotide-binding, and a RasGEF domain.

Alternate Names

DKFZp667N084, DKFZp686I15116, KIA001LB, PDZ domain-containing guanine nucleotide exchange factor 2, PDZ domain-containing guanine nucleotide exchange factor I, PDZ-GEF2RA-GEF-2PDZGEF2PDZ domain containing guanine nucleotide exchange factor (GEF) 2, RAGEF2, Rap guanine nucleotide exchange factor (GEF) 6, rap guanine nucleotide exchange factor 6

Gene Symbol

RAPGEF6

Additional RAGEF2 Products

Product Documents for RAGEF2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RAGEF2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAGEF2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAGEF2 Antibody - BSA Free and earn rewards!

Have you used RAGEF2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies