RAIDD/CRADD Antibody (7M7M6)

Novus Biologicals | Catalog # NBP3-16673

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7M7M6 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-150 of human CRADD (P78560). DTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RAIDD/CRADD Antibody (7M7M6)

Western Blot: RAIDD/CRADD Antibody (7M7M6) [NBP3-16673]

Western Blot: RAIDD/CRADD Antibody (7M7M6) [NBP3-16673]

Western Blot: RAIDD/CRADD Antibody (7M7M6) [NBP3-16673] - Western blot analysis of extracts of various cell lines, using RAIDD/CRADD Rabbit mAb (NBP3-16673) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.
Immunohistochemistry-Paraffin: RAIDD/CRADD Antibody (7M7M6) [NBP3-16673]

Immunohistochemistry-Paraffin: RAIDD/CRADD Antibody (7M7M6) [NBP3-16673]

Immunohistochemistry-Paraffin: RAIDD/CRADD Antibody (7M7M6) [NBP3-16673] - Immunohistochemistry of paraffin-embedded human breast using RAIDD/CRADD Rabbit mAb (NBP3-16673) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for RAIDD/CRADD Antibody (7M7M6)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CRADD

Apoptosis is triggered by activation of initiator caspases upon complex-mediated clustering of the inactive zymogen, as occurs in the caspase-9-activating apoptosome complex. Activation of caspase-2 occurs in a complex that contains the death domain-containing protein PIDD, whose expression is induced by p53, and the adaptor protein RAIDD (1). RAIDD has a dual-domain structure similar to that of FADD. It has an NH2-terminal caspase homology domain that interacts with caspase-2 and a COOH-terminal DD that interacts with RIP. RAIDD is constitutively expressed in many tissues and thus could play a role in regulating apoptosis in mammalian cells (2). In metazoan cells there exists inactive polypeptide precursors (zymogens), each composed of a prodomain, which is cleaved to activate the protease, and a large and small catalytic subunit. The coupling of these proteases to signaling pathways is probably mediated by adaptor molecules that contain protein-protein interaction motifs such as the death domain (3).

Long Name

CASP2 and RIPK1 Domain Containing Adaptor With Death Domain

Alternate Names

RAIDD

Gene Symbol

CRADD

Additional CRADD Products

Product Documents for RAIDD/CRADD Antibody (7M7M6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAIDD/CRADD Antibody (7M7M6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for RAIDD/CRADD Antibody (7M7M6)

There are currently no reviews for this product. Be the first to review RAIDD/CRADD Antibody (7M7M6) and earn rewards!

Have you used RAIDD/CRADD Antibody (7M7M6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Apoptosis Signaling Pathway
Apoptosis Signaling Pathway Thumbnail