RALGPS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84645

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: STLSSGISIGSSDGSELSEETSWPAFERNRLYHSLGPVTRVARNGYRSHMKASSSAESEDLAVHLYPGAVTIQGVLR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RALGPS2 Antibody - BSA Free

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645]

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645]

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645] - Staining in human testis and pancreas tissues using anti-RALGPS2 antibody. Corresponding RALGPS2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645]

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645]

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645] - Staining of human colon, liver, lymph node and testis using Anti-RALGPS2 antibody NBP1-84645 (A) shows similar protein distribution across tissues to independent antibody NBP1-84646 (B).
Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645]

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645]

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645] - Staining of human liver.
Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645]

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645]

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645]

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645]

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645]

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645]

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645] - Staining of human colon.
Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645]

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645]

Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84645] - Staining of human lymph node.
RALGPS2 Antibody - BSA Free Western Blot: RALGPS2 Antibody - BSA Free [NBP1-84645]

Western Blot: RALGPS2 Antibody - BSA Free [NBP1-84645]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Applications for RALGPS2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RALGPS2

Guanine nucleotide exchange factor for the small GTPase RALA. May be involved in cytoskeletal organization. May also be involved in the stimulation of transcription in a Ras-independent fashion

Alternate Names

dJ595C2.1, FLJ10244, FLJ25604, KIAA0351, Ral GEF with PH domain and SH3 binding motif 2, Ral GEF with PH domain and SH3-binding motif 2, RalA exchange factor RalGPS2, Ral-A exchange factor RalGPS2, ras-specific guanine nucleotide-releasing factor RalGPS2

Gene Symbol

RALGPS2

Additional RALGPS2 Products

Product Documents for RALGPS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RALGPS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RALGPS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RALGPS2 Antibody - BSA Free and earn rewards!

Have you used RALGPS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...