RanGAP1 Antibody (1E7R7)

Novus Biologicals | Catalog # NBP3-16697

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1E7R7 expressed in HEK293
View all RanGAP1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RanGAP1 (P46060). MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPAL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RanGAP1 Antibody (1E7R7)

Western Blot: RanGAP1 Antibody (1E7R7) [NBP3-16697]

Western Blot: RanGAP1 Antibody (1E7R7) [NBP3-16697]

Western Blot: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Western blot analysis of extracts of various cell lines, using RanGAP1 Rabbit mAb (NBP3-16697) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunocytochemistry/ Immunofluorescence: RanGAP1 Antibody (1E7R7) [NBP3-16697]

Immunocytochemistry/ Immunofluorescence: RanGAP1 Antibody (1E7R7) [NBP3-16697]

Immunocytochemistry/Immunofluorescence: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunofluorescence analysis of U-2 OS cells using RanGAP1 Rabbit mAb (NBP3-16697) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: RanGAP1 Antibody (1E7R7) [NBP3-16697]

Immunocytochemistry/ Immunofluorescence: RanGAP1 Antibody (1E7R7) [NBP3-16697]

Immunocytochemistry/Immunofluorescence: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunofluorescence analysis of C6 cells using RanGAP1 Rabbit mAb (NBP3-16697) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: RanGAP1 Antibody (1E7R7) [NBP3-16697]

Immunocytochemistry/ Immunofluorescence: RanGAP1 Antibody (1E7R7) [NBP3-16697]

Immunocytochemistry/Immunofluorescence: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunofluorescence analysis of NIH-3T3 cells using RanGAP1 Rabbit mAb (NBP3-16697) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
RanGAP1 Antibody (1E7R7)

Immunohistochemistry: RanGAP1 Antibody (1E7R7) [NBP3-16697] -

Immunohistochemistry: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunohistochemistry analysis of RanGAP1 in paraffin-embedded rat testis tissue using RanGAP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
RanGAP1 Antibody (1E7R7)

Immunohistochemistry: RanGAP1 Antibody (1E7R7) [NBP3-16697] -

Immunohistochemistry: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunohistochemistry analysis of RanGAP1 in paraffin-embedded mouse kidney tissue using RanGAP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
RanGAP1 Antibody (1E7R7)

Immunohistochemistry: RanGAP1 Antibody (1E7R7) [NBP3-16697] -

Immunohistochemistry: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunohistochemistry analysis of RanGAP1 in paraffin-embedded rat liver tissue using RanGAP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
RanGAP1 Antibody (1E7R7)

Immunocytochemistry/ Immunofluorescence: RanGAP1 Antibody (1E7R7) [NBP3-16697] -

Immunocytochemistry/ Immunofluorescence: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunofluorescence analysis of NIH-3T3 cells using RanGAP1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
RanGAP1 Antibody (1E7R7)

Immunohistochemistry: RanGAP1 Antibody (1E7R7) [NBP3-16697] -

Immunohistochemistry: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunohistochemistry analysis of RanGAP1 in paraffin-embedded human colon carcinoma tissue using RanGAP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
RanGAP1 Antibody (1E7R7)

Immunohistochemistry: RanGAP1 Antibody (1E7R7) [NBP3-16697] -

Immunohistochemistry: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunohistochemistry analysis of RanGAP1 in paraffin-embedded mouse brain tissue using RanGAP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for RanGAP1 Antibody (1E7R7)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RanGAP1

RanGAP1, is a homodimeric 65-kD polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state. The RANGAP1 gene encodes a 587-amino acid polypeptide. The sequence is unrelated to that of GTPase activators for other RAS-related proteins, but is 88% identical to Fug1, the murine homolog of yeast Rna1p. RanGAP1 and RCC1 control RAN-dependent transport between the nucleus and cytoplasm. RanGAP1 is a key regulator of the RAN GTP/GDP cycle.

Long Name

Ran GTPase Activating Protein 1

Alternate Names

Fug1

Gene Symbol

RANGAP1

Additional RanGAP1 Products

Product Documents for RanGAP1 Antibody (1E7R7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RanGAP1 Antibody (1E7R7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RanGAP1 Antibody (1E7R7)

There are currently no reviews for this product. Be the first to review RanGAP1 Antibody (1E7R7) and earn rewards!

Have you used RanGAP1 Antibody (1E7R7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies