RAPGEFL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86763

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RAPGEFL1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RAPGEFL1. Peptide sequence: RLHQLVETVELKIPEENQPPSKQVKPLFRHFRRIDSCLQTRVAFRGSDEI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RAPGEFL1 Antibody - BSA Free

Western Blot: RAPGEFL1 Antibody [NBP2-86763]

Western Blot: RAPGEFL1 Antibody [NBP2-86763]

Western Blot: RAPGEFL1 Antibody [NBP2-86763] - Host: Rabbit. Target Name: RAPGEFL1. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for RAPGEFL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAPGEFL1

RAPGEFL1, also known as Rap guanine nucleotide exchange factor-like 1, has a 662 amino acid long isoform that is approximately 73kDa, and two shorter isoforms that are 456 amino acids and 511 amino acids, respectively. Research shows that RAPGEFL1 is likely a guanine nucleotide exchange factor, which activates GTPases via the release of GDP and binding of GTP. RAPGEFL1 has also been shown to interact with MLH1.

Alternate Names

Link GEFII, Link guanine nucleotide exchange factor II, Link-GEFII, MGC134798, MGC134799, Rap guanine nucleotide exchange factor (GEF)-like 1, rap guanine nucleotide exchange factor-like 1, RAP guanine-nucleotide-exchange factor (GEF)-like 1

Gene Symbol

RAPGEFL1

Additional RAPGEFL1 Products

Product Documents for RAPGEFL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAPGEFL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAPGEFL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAPGEFL1 Antibody - BSA Free and earn rewards!

Have you used RAPGEFL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies