RB associated KRAB repressor Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85608

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RB associated KRAB repressor. Peptide sequence: HYRSHLEEKPYECNECGKTFNLNSAFIRHRKVHTEEKSHECSECGKFSQL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RB associated KRAB repressor Antibody - BSA Free

Western Blot: RB associated KRAB repressor Antibody [NBP2-85608]

Western Blot: RB associated KRAB repressor Antibody [NBP2-85608]

Western Blot: RB associated KRAB repressor Antibody [NBP2-85608] - WB Suggested Anti-RBAK Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysate
Immunohistochemistry: RB associated KRAB repressor Antibody [NBP2-85608]

Immunohistochemistry: RB associated KRAB repressor Antibody [NBP2-85608]

Immunohistochemistry: RB associated KRAB repressor Antibody [NBP2-85608] - Human kidney

Applications for RB associated KRAB repressor Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RB associated KRAB repressor

RB associated KRAB repressor, also known as ZNF769, consists of a 83 kDa 714 and a shorter 12 kDa 113 isoform. Its function is to promote AR-dependent transcription by encoding a nuclear protein. Current research on RB associated KRAB repressor is being conducted in its relationship to retinoblastoma, hyperaldosteronism and familial hyperaldosteronism. RB associated KRAB repressor is known to interact with SUMO1, RB1, AR and SMARCAD1.

Alternate Names

hRBaK, RB-associated KRAB repressor, RB-associated KRAB zinc finger, RB-associated KRAB zinc finger protein, ZNF769Zinc finger protein 769

Gene Symbol

RBAK

Additional RB associated KRAB repressor Products

Product Documents for RB associated KRAB repressor Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RB associated KRAB repressor Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RB associated KRAB repressor Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RB associated KRAB repressor Antibody - BSA Free and earn rewards!

Have you used RB associated KRAB repressor Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...