RBBP4/RbAp48 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56286

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RBBP4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RBBP4/RbAp48 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RBBP4/RbAp48 Antibody [NBP2-56286]

Immunocytochemistry/ Immunofluorescence: RBBP4/RbAp48 Antibody [NBP2-56286]

Immunocytochemistry/Immunofluorescence: RBBP4/RbAp48 Antibody [NBP2-56286] - Staining of human cell line HeLa shows localization to nucleoplasm.
RBBP4/RbAp48 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: RBBP4/RbAp48 Antibody - BSA Free [NBP2-56286]

Chromatin Immunoprecipitation-exo-Seq: RBBP4/RbAp48 Antibody - BSA Free [NBP2-56286]

ChIP-Exo-Seq composite graph for Anti-RBBP4 (NBP2-56286) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for RBBP4/RbAp48 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RBBP4

RbAp48 encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes.

Long Name

Retinoblastoma Binding Protein 4

Alternate Names

CAF-1 p48, CAF-1C, NURF55, RBAP48

Gene Symbol

RBBP4

Additional RBBP4 Products

Product Documents for RBBP4/RbAp48 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RBBP4/RbAp48 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RBBP4/RbAp48 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RBBP4/RbAp48 Antibody - BSA Free and earn rewards!

Have you used RBBP4/RbAp48 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies