RBCK1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88301

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Applications

Validated:

Western Blot

Cited:

Western Blot, Immunoblotting, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30209176). Expected reactivity in Rat (88%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RBCK1 Antibody - BSA Free

RBCK1 Antibody - BSA Free Western Blot: RBCK1 Antibody - BSA Free [NBP1-88301]

Western Blot: RBCK1 Antibody - BSA Free [NBP1-88301]

Analysis in human cell lines SK-MEL-30 and HeLa using Anti-RBCK1 antibody. Corresponding RBCK1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
RBCK1 Antibody - BSA Free

Western Blot: RBCK1 Antibody - BSA Free [NBP1-88301] -

Expression of RNF31 in HCC cell lines and evaluation of RNF31 knockdown. (a) The mRNA level of RNF31 was evaluated in the HepG2, Hep3B, PLC, Huh7, HLE, and HLF cell lines by qPCR. mRNA level of RNF31 in Huh7 cells was used as reference. (b) The protein expression levels of RNF31, RBCK1, and SHARPIN were evaluated by Western blotting. (c) The effect of RNF31 knockdown was evaluated using Western blotting for HepG2, Hep3B, and PLC cells transfected with control (siCont) and RNF31-specific siRNAs (siRNA1-3). For quantification, normalized RNF31/b-actin level in parental cells was used as reference. d. The effect of RNF31 knockdown was evaluated using qPCRs. mRNA level of RNF31/GAPDH in control cells was used as reference. *P < 0.05; ns, non-specific; n.s., not significant; siCont, control siRNA. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-023-50594-3), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
RBCK1 Antibody - BSA Free

Western Blot: RBCK1 Antibody - BSA Free [NBP1-88301] -

Inhibition of RNF31 with HOIPIN-8 decreases proliferation, invasion, and NF-kappa B activation in HCC cell lines. (a) Cell proliferation was evaluated in HepG2 and Hep3B cells treated with 100 uM HOIPIN-8. (b) Invasion was evaluated in HepG2 and Hep3B cells in the presence of 10 or 30 uM HOIPIN-8. Representative images of invading cells are shown in the right panel. Cell nuclei are stained in purple. (c) Expression of NF-kappa B target genes in HepG2 and Hep3B cells was evaluated by qPCR. Cells were pretreated with 30 uM HOIPIN-8 for 1 h, followed by stimulation with 10 ng/mL TNF-alpha for 2 h. (d) Phosphorylation of NF-kappa B signaling factors upon TNF-alpha stimulation was evaluated in HepG2 cells with or without 30 uM HOIPIN-8. Cell lysates were immunoblotted by the indicated antibodies. (e) Effect of HOIPIN-8 on TNF-alpha + CHX-mediated apoptosis in HepG2 and Hep3B cells. Cells were pre-treated with HOIPIN-8 for 1 h and then stimulated with 40 ng/mL TNF-alpha and 20 ug/mL CHX for 0, 4, and 8 h, and cell lysates were immunoblotted by the indicated antibodies. *P < 0.05; n.s., not significant; Cas-3, caspase-3; cl-Cas-3, cleaved caspase-3; CHX, cycloheximide. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-023-50594-3), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
RBCK1 Antibody - BSA Free

Western Blot: RBCK1 Antibody - BSA Free [NBP1-88301] -

RNF31 knockdown inhibits TNF-alpha -induced NF-kappa B activation in HCC cell lines. (a) NF-kappa B activity was evaluated in HepG2 and Hep3B cells transfected with RNF31 siRNAs using a dual luciferase assay. Cells were treated with TNF-alpha at 10 ng/mL for 6 h. (b) Evaluation of phosphorylation of NF-kappa B signaling factors induced by TNF-alpha in HepG2 cells after RNF31 knockdown. *P < 0.05; n.s., not significant; siCont, control siRNA. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-023-50594-3), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
RBCK1 Antibody - BSA Free

Western Blot: RBCK1 Antibody - BSA Free [NBP1-88301] -

Expression of RNF31 in HCC cell lines and evaluation of RNF31 knockdown. (a) The mRNA level of RNF31 was evaluated in the HepG2, Hep3B, PLC, Huh7, HLE, and HLF cell lines by qPCR. mRNA level of RNF31 in Huh7 cells was used as reference. (b) The protein expression levels of RNF31, RBCK1, and SHARPIN were evaluated by Western blotting. (c) The effect of RNF31 knockdown was evaluated using Western blotting for HepG2, Hep3B, and PLC cells transfected with control (siCont) and RNF31-specific siRNAs (siRNA1-3). For quantification, normalized RNF31/b-actin level in parental cells was used as reference. d. The effect of RNF31 knockdown was evaluated using qPCRs. mRNA level of RNF31/GAPDH in control cells was used as reference. *P < 0.05; ns, non-specific; n.s., not significant; siCont, control siRNA. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41598-023-50594-3), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for RBCK1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

0.04 - 0.4 ug/ml

Reviewed Applications

Read 1 review rated 4 using NBP1-88301 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RBCK1

RBCK1 is encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms. [provided by RefSeq]

Alternate Names

C20orf18, EC 6.3.2.-, HBV associated factor 4, HBV-associated factor 4, Heme-oxidized IRP2 ubiquitin ligase 1, Hepatitis B virus X-associated protein 4, HOIL-1, RanBP-type and C3HC4-type zinc finger containing 1, ranBP-type and C3HC4-type zinc finger-containing protein 1, RBCC protein interacting with PKC1, RBCK2, RNF54RING finger protein 54, UBCE7IP3HOIL1, ubiquitin conjugating enzyme 7 interacting protein 3, Ubiquitin-conjugating enzyme 7-interacting protein 3, XAP3, XAP4chromosome 20 open reading frame 18, ZRANB4

Gene Symbol

RBCK1

Additional RBCK1 Products

Product Documents for RBCK1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RBCK1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RBCK1 Antibody - BSA Free

Customer Reviews for RBCK1 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used RBCK1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card
Showing  1 - 1 of 1 review Showing All
Filter By:
  • RBCK1 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Bone marrow-derived dendritic cells
    Species: Mouse
    Verified Customer | Posted 04/28/2017
    5% NFDM in TBS-T was used for blocking, primary and secondary antibody incubations.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...