Recombinant Human CD44v6 Fc Chimera Protein, CF

Catalog # Availability Size / Price Qty
11175-CD-050

Save 15% on Select RUO Reagents. See Details

Recombinant Human CD44v6 Fc Chimera Protein Binding Activity.
2 Images
Product Details
FAQs
Reviews

Recombinant Human CD44v6 Fc Chimera Protein, CF Summary

  • R&D Systems CHO-derived Recombinant Human CD44v6 Fc Chimera Protein (11175-CD)
  • Quality control testing to verify active proteins with lot specific assays by in-house scientists
  • All R&D Systems proteins are covered with a 100% guarantee

Product Specifications

Purity
>95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
Endotoxin Level
<0.10 EU per 1 μg of the protein by the LAL method.
Activity
Measured by its binding ability in a functional ELISA. When Recombinant Human CD44v6 Fc Chimera (Catalog # 11175-CD) is immobilized at 1 µg/mL (100 µL/well), Biotinylated Hyaluronan binds with an ED50 of 4.00-40.0 ng/mL.
Source
Chinese Hamster Ovary cell line, CHO-derived human CD44 protein
Human CD44v6
(Gln21-Thr222)
(IQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAG)(Asp224-Trp269)
Accession # NP_001001391.1
GGIEGRMD Human IgG1
(Pro100-Lys330)
N-terminusC-terminus
Accession #
N-terminal Sequence
Analysis
Gln21
Structure / Form
Disulfide-linked homodimer
Predicted Molecular Mass
59 kDa
SDS-PAGE
105-120 kDa, under reducing conditions.

Product Datasheets

You must select a language.

x

11175-CD

Carrier Free

What does CF mean?

CF stands for Carrier Free (CF). We typically add Bovine Serum Albumin (BSA) as a carrier protein to our recombinant proteins. Adding a carrier protein enhances protein stability, increases shelf-life, and allows the recombinant protein to be stored at a more dilute concentration. The carrier free version does not contain BSA.

What formulation is right for me?

In general, we advise purchasing the recombinant protein with BSA for use in cell or tissue culture, or as an ELISA standard. In contrast, the carrier free protein is recommended for applications, in which the presence of BSA could interfere.

11175-CD

Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Reconstitution Reconstitute at 500 μg/mL in PBS.
Shipping The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
  • 12 months from date of receipt, -20 to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
  • 3 months, -20 to -70 °C under sterile conditions after reconstitution.

Scientific Data

Binding Activity View Larger

When Recombinant Human CD44v6 Fc Chimera Protein (Catalog # 11175-CD) is immobilized at 1 µg/mL (100 µL/well), Biotinylated Hyaluronan binds with an ED50 of 4.00-40.0 ng/mL.

SDS-PAGE View Larger

2 μg/lane of Recombinant Human CD44v6 Fc Chimera Protein (Catalog # 11175-CD) was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by Coomassie® Blue staining, showing bands at 105-120 kDa and 210-240 kDa, respectively.

Reconstitution Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Background: CD44

CD44 is a ubiquitously expressed protein that is the major receptor for hyaluronan and exerts control over cell growth and migration (1-3). Human CD44 has a 20 amino acid (aa) signal sequence, an extracellular domain (ECD) with a 100 aa hyaluronan-binding disulfide-stabilized link region and a 325-530 aa stem region, a 21 aa transmembrane domain, and a 72 aa cytoplasmic domain. CD44 transcripts undergo complex alternative splicing, and, within the stem, ten variably spliced exons (v1‑10 corresponding to exons 6-15; although human CD44 lacks v1/exon 6) produce multiple protein isoforms (1-4). The standard or hematopoietic form, CD44H, does not include the variable segments (1-4). Cancer aggressiveness and T cell activation have been correlated with expression of specific isoforms (1, 4, 5). Human CD44v6 contains exon 11 (v6) and is involved in many biological processes including cell growth, apoptosis, and metastasis (6-7). With variable N- and O‑glycosylation and splicing within the stalk, CD44 can range from 80 to 200 kDa (1). Within the N-terminal invariant portion of the ECD (aa 21-222), human CD44 shares 76%, 76%, 86%, 83% and 79% identity with corresponding mouse, rat, equine, canine and bovine CD44, respectively. The many reported functions of CD44 fall within three categories (1). First, CD44 binds hyaluronan and other ligands within the extracellular matrix and can function as a "platform" for growth factors and metalloproteinases. Second, CD44 can function as a co-receptor that modifies activity of receptors including MET and the ERBB family of tyrosine kinases. Third, the CD44 intracellular domain links the plasma membrane to the actin cytoskeleton via the ERM proteins, ezrin, radixin and moesin. CD44 can be synthesized in a soluble form (8) or may be cleaved at multiple sites by either membrane-type matrix metalloproteinases, or ADAM proteases to produce soluble ectodomains (9-10). The cellular portion may then undergo gamma secretase-dependent intramembrane cleavage to form an A beta-like transmembrane portion and a cytoplasmic signaling portion that affects gene expression (11‑12). These cleavage events are thought to promote metastasis by enhancing tumor cell motility and growth (1, 8). CD44v6 plays an important role in colorectal cancer progression involving in cell colonization, invasion, and metastasis and is considered a functional cancer biomarker (7).

References
  1. Ponta, H. et al. (2003) Nat. Rev. Mol. Cell Biol. 4:33.
  2. Screaton, G.R. et al. (1992) Proc. Natl. Acad. Sci. USA 89:12160.
  3. Screaton, G.R. et al. (1993) J. Biol. Chem. 268:12235.
  4. Lynch, K.W. (2004) Nat. Rev. Immunol. 4:931.
  5. Todaro, M. et al. (2014) Cell stem cell 14:342.
  6. Vizoso, F.J. et al. (2004) J. Cancer Res. Clin. Oncol. 130:679.
  7. Ma, L. et al. (2019) Cell Death Dis. 10:30.
  8. Yu, Q. and B.P. Toole (1996) J. Biol. Chem. 271:20603.
  9. Nagano, O. and H. Saya (2004) Cancer Sci. 95:930.
  10. Nakamura, H. et al. (2004) Cancer Res. 64:876.
  11. Murakami, D. et al. (2003) Oncogene 22:1511.
  12. Lammich, S. et al. (2002) J. Biol. Chem. 277:44754.
Entrez Gene IDs
960 (Human); 12505 (Mouse); 25406 (Rat); 100126860 (Porcine)
Alternate Names
CD44 antigen; CD44 molecule (Indian blood group); CD44; CD44R; CDw44; cell surface glycoprotein CD44; chondroitin sulfate proteoglycan 8; CSPG8; ECMR-III; epican; Extracellular matrix receptor III; GP90 lymphocyte homing/adhesion receptor; HCAM; HCELL; hematopoietic cell E- and L-selectin ligand; Heparan sulfate proteoglycan; Hermes antigen; homing function and Indian blood group system; HUTCH-I; Hyaluronate receptor; IN; LHR; MC56; MDU2; MDU2CD44 antigen (homing function and Indian blood group system); MDU3; MDU3CDW44; MIC4; MIC4MGC10468; MUTCH-I; Pgp1; PGP-1; PGP-I; Phagocytic glycoprotein 1; Phagocytic glycoprotein I

FAQs

No product specific FAQs exist for this product, however you may

View all Proteins and Enzyme FAQs

Reviews for Recombinant Human CD44v6 Fc Chimera Protein, CF

There are currently no reviews for this product. Be the first to review Recombinant Human CD44v6 Fc Chimera Protein, CF and earn rewards!

Have you used Recombinant Human CD44v6 Fc Chimera Protein, CF?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review