Recombinant Human CD44v6 Fc Chimera Protein, CF

R&D Systems | Catalog # 11175-CD

R&D Systems
Loading...

Key Product Details

  • R&D Systems CHO-derived Recombinant Human CD44v6 Fc Chimera Protein (11175-CD)
  • Quality control testing to verify active proteins with lot specific assays by in-house scientists
  • All R&D Systems proteins are covered with a 100% guarantee

Source

CHO

Accession Number

Structure / Form

Disulfide-linked homodimer

Applications

Bioactivity
Loading...

Product Specifications

Source

Chinese Hamster Ovary cell line, CHO-derived human CD44 protein
Human CD44v6
(Gln21-Thr222)
(IQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAG)(Asp224-Trp269)
Accession # NP_001001391.1
GGIEGRMD Human IgG1
(Pro100-Lys330)
N-terminus C-terminus

Purity

>95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.

Endotoxin Level

<0.10 EU per 1 μg of the protein by the LAL method.

N-terminal Sequence Analysis

Gln21

Predicted Molecular Mass

59 kDa

SDS-PAGE

105-120 kDa, under reducing conditions.

Activity

Measured by its binding ability in a functional ELISA.
When Recombinant Human CD44v6 Fc Chimera (Catalog # 11175-CD) is immobilized at 1 µg/mL (100 µL/well), Biotinylated Hyaluronan binds with an ED50 of 4.00-40.0 ng/mL.

Scientific Data Images for Recombinant Human CD44v6 Fc Chimera Protein, CF

Recombinant Human CD44v6 Fc Chimera Protein Binding Activity.

When Recombinant Human CD44v6 Fc Chimera Protein (Catalog # 11175-CD) is immobilized at 1 µg/mL (100 µL/well), Biotinylated Hyaluronan binds with an ED50 of 4.00-40.0 ng/mL.

Recombinant Human CD44v6 Fc Chimera Protein SDS-PAGE.

2 μg/lane of Recombinant Human CD44v6 Fc Chimera Protein (Catalog # 11175-CD) was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by Coomassie® Blue staining, showing bands at 105-120 kDa and 210-240 kDa, respectively.

Formulation, Preparation, and Storage

11175-CD
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Reconstitution Reconstitute at 500 μg/mL in PBS.
Shipping The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
  • 12 months from date of receipt, -20 to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
  • 3 months, -20 to -70 °C under sterile conditions after reconstitution.

Calculators

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Background: CD44

CD44 is a ubiquitously expressed protein that is the major receptor for hyaluronan and exerts control over cell growth and migration (1-3). Human CD44 has a 20 amino acid (aa) signal sequence, an extracellular domain (ECD) with a 100 aa hyaluronan-binding disulfide-stabilized link region and a 325-530 aa stem region, a 21 aa transmembrane domain, and a 72 aa cytoplasmic domain. CD44 transcripts undergo complex alternative splicing, and, within the stem, ten variably spliced exons (v1‑10 corresponding to exons 6-15; although human CD44 lacks v1/exon 6) produce multiple protein isoforms (1-4). The standard or hematopoietic form, CD44H, does not include the variable segments (1-4). Cancer aggressiveness and T cell activation have been correlated with expression of specific isoforms (1, 4, 5). Human CD44v6 contains exon 11 (v6) and is involved in many biological processes including cell growth, apoptosis, and metastasis (6-7). With variable N- and O‑glycosylation and splicing within the stalk, CD44 can range from 80 to 200 kDa (1). Within the N-terminal invariant portion of the ECD (aa 21-222), human CD44 shares 76%, 76%, 86%, 83% and 79% identity with corresponding mouse, rat, equine, canine and bovine CD44, respectively. The many reported functions of CD44 fall within three categories (1). First, CD44 binds hyaluronan and other ligands within the extracellular matrix and can function as a "platform" for growth factors and metalloproteinases. Second, CD44 can function as a co-receptor that modifies activity of receptors including MET and the ERBB family of tyrosine kinases. Third, the CD44 intracellular domain links the plasma membrane to the actin cytoskeleton via the ERM proteins, ezrin, radixin and moesin. CD44 can be synthesized in a soluble form (8) or may be cleaved at multiple sites by either membrane-type matrix metalloproteinases, or ADAM proteases to produce soluble ectodomains (9-10). The cellular portion may then undergo gamma secretase-dependent intramembrane cleavage to form an A beta-like transmembrane portion and a cytoplasmic signaling portion that affects gene expression (11‑12). These cleavage events are thought to promote metastasis by enhancing tumor cell motility and growth (1, 8). CD44v6 plays an important role in colorectal cancer progression involving in cell colonization, invasion, and metastasis and is considered a functional cancer biomarker (7).

References

  1. Ponta, H. et al. (2003) Nat. Rev. Mol. Cell Biol. 4:33.
  2. Screaton, G.R. et al. (1992) Proc. Natl. Acad. Sci. USA 89:12160.
  3. Screaton, G.R. et al. (1993) J. Biol. Chem. 268:12235.
  4. Lynch, K.W. (2004) Nat. Rev. Immunol. 4:931.
  5. Todaro, M. et al. (2014) Cell stem cell 14:342.
  6. Vizoso, F.J. et al. (2004) J. Cancer Res. Clin. Oncol. 130:679.
  7. Ma, L. et al. (2019) Cell Death Dis. 10:30.
  8. Yu, Q. and B.P. Toole (1996) J. Biol. Chem. 271:20603.
  9. Nagano, O. and H. Saya (2004) Cancer Sci. 95:930.
  10. Nakamura, H. et al. (2004) Cancer Res. 64:876.
  11. Murakami, D. et al. (2003) Oncogene 22:1511.
  12. Lammich, S. et al. (2002) J. Biol. Chem. 277:44754.

Alternate Names

CD44, ECMR-III, HCAM, HCELL, LHR, MDU2, MDU3, MIC4, MUTCH-I, Pgp1

Entrez Gene IDs

960 (Human); 12505 (Mouse); 25406 (Rat); 100126860 (Porcine)

Gene Symbol

CD44

UniProt

Additional CD44 Products

Product Documents for Recombinant Human CD44v6 Fc Chimera Protein, CF

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Note: Certificate of Analysis not available for kit components.

Product Specific Notices for Recombinant Human CD44v6 Fc Chimera Protein, CF

For research use only

Customer Reviews for Recombinant Human CD44v6 Fc Chimera Protein, CF

There are currently no reviews for this product. Be the first to review Recombinant Human CD44v6 Fc Chimera Protein, CF and earn rewards!

Have you used Recombinant Human CD44v6 Fc Chimera Protein, CF?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes