Reg3A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48903

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Reg3A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KAYGSHCYALFLSPKSWTDADLACQKRPSGNL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Reg3A Antibody - BSA Free (NBP2-48903) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Reg3A Antibody - BSA Free

Immunohistochemistry: Reg3A Antibody [NBP2-48903]

Immunohistochemistry: Reg3A Antibody [NBP2-48903]

Immunohistochemistry: Reg3A Antibody [NBP2-48903] - Staining of human small intestine shows strong cytoplasmic positivity in subset of glandular cells.
Reg3A Antibody - BSA Free

Reg3A Antibody [NBP2-48903] -

Analysis in human small intestine and skeletal muscle tissues using NBP2-48903 antibody. Corresponding REG3A RNA-seq data are presented for the same tissues.
Reg3A Antibody - BSA Free

Reg3A Antibody [NBP2-48903] -

Staining of human liver shows no positivity in hepatocytes as expected.
Reg3A Antibody - BSA Free

Reg3A Antibody [NBP2-48903] -

Staining of human kidney shows no positivity in cells in tubules as expected.
Reg3A Antibody - BSA Free

Reg3A Antibody [NBP2-48903] -

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for Reg3A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Reg3A

The Reg3a gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver c

Long Name

Regenerating Islet-derived IIIa

Alternate Names

Lithostathine 3, PAP2, REG3A

Gene Symbol

REG3A

Additional Reg3A Products

Product Documents for Reg3A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Reg3A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

C-type Lectin Family
Diabetes

Customer Reviews for Reg3A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Reg3A Antibody - BSA Free and earn rewards!

Have you used Reg3A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies