REM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13217

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all REM1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: QEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSESSDSEGSWEALYRVVLLGD

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for REM1 Antibody - BSA Free

Immunohistochemistry-Paraffin: REM1 Antibody [NBP2-13217]

Immunohistochemistry-Paraffin: REM1 Antibody [NBP2-13217]

Immunohistochemistry-Paraffin: REM1 Antibody [NBP2-13217] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Applications for REM1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: REM1

The Ras-encoded family of proteins bind GDP and GTP with high affinity. They possess a low level of intrinsic GTPase activity that increases more than 100-fold when interacting with cytosolic GTPase activating protein (GAP). Ras family members include H-Ras, K-Ras, N-Ras, M-Ras, R-Ras, ERas, Rheb, TC 21, RASL11B and Rad (Ras associated with diabetes) GTPase.Rad GTPase is a GTP-binding protein that is similar to Ras but has unique features. Unlike other small GTPases, Rad GTPase lacks typical pren-ylation motifs at its C terminus. The Rad GTPase enzyme binds calmodulin, inhibits vascular lesion formation, has low intrinsic GTPase activity and cannot be stimulated by any known GAP molecules. Rad GTPase is expressed in skeletal muscle, cardiac muscle and lung tissues and is overexpressed in the skeletal muscle tissue of individuals with type II diabetes.

Alternate Names

GESGD:REM, GTPase GES, GTPase-regulating endothelial cell sprouting, GTP-binding protein REM 1, MGC48669, Rad and Gem-like GTP-binding protein 1, RAS (RAD and GEM)-like GTP-binding, RAS (RAD and GEM)-like GTP-binding 1, REM

Gene Symbol

REM1

Additional REM1 Products

Product Documents for REM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for REM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for REM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review REM1 Antibody - BSA Free and earn rewards!

Have you used REM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies