Recombinant Human Rev-erb beta/NR1D2 GST (N-Term) Protein

Novus Biologicals | Catalog # H00009975-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection
Loading...

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-579 of Human NR1D2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPKRGERIRKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

89.21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Rev-erb beta/NR1D2 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00009975-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Rev-erb beta/NR1D2

NR1D2( AAH45613, 1 a.a. - 580 a.a.) recombinant protein with GST.

Alternate Names

BD73, EAR-1R, NR1D2, Reverb beta

Gene Symbol

NR1D2

Additional Rev-erb beta/NR1D2 Products

Product Documents for Recombinant Human Rev-erb beta/NR1D2 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human Rev-erb beta/NR1D2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human Rev-erb beta/NR1D2 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human Rev-erb beta/NR1D2 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human Rev-erb beta/NR1D2 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human Rev-erb beta/NR1D2 GST (N-Term) Protein

Showing  1 - 2 of 2 FAQs Showing All
  • Q: Are there any post-translational modifications?

    A: Both H00009572-P01 and H00009975-P01 are produced using the in vitro wheat germ expression system which allows for expression of mammalian proteins with proper glycosylation and native post-translational modifications (PTM).

  • Q: Can these proteins be cleaved of their GST tag? If so how? Thrombin? GST tag Removal using GE Healthcare's PreScission Protease?

    A: The GST tag can be cleaved using our protocol which is available on our website under the Support area. This protocol uses GE Healthcare's Prescission protease.

  • Q: Are there any post-translational modifications?

    A: Both H00009572-P01 and H00009975-P01 are produced using the in vitro wheat germ expression system which allows for expression of mammalian proteins with proper glycosylation and native post-translational modifications (PTM).

  • Q: Can these proteins be cleaved of their GST tag? If so how? Thrombin? GST tag Removal using GE Healthcare's PreScission Protease?

    A: The GST tag can be cleaved using our protocol which is available on our website under the Support area. This protocol uses GE Healthcare's Prescission protease.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Proteins and Enzymes
Loading...