REXO2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85666

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (96%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all REXO2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for REXO2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: REXO2 Antibody [NBP1-85666]

Immunocytochemistry/ Immunofluorescence: REXO2 Antibody [NBP1-85666]

Immunocytochemistry/Immunofluorescence: REXO2 Antibody [NBP1-85666] - Staining of human cell line U-251 MG shows positivity in mitochondria. Antibody staining is shown in green.
REXO2 Antibody - BSA Free Western Blot: REXO2 Antibody - BSA Free [NBP1-85666]

Western Blot: REXO2 Antibody - BSA Free [NBP1-85666]

Analysis in human cell line U-2 OS.
REXO2 Antibody - BSA Free Immunohistochemistry-Paraffin: REXO2 Antibody - BSA Free [NBP1-85666]

Immunohistochemistry-Paraffin: REXO2 Antibody - BSA Free [NBP1-85666]

Staining of human cerebral cortex shows weak cytoplasmic positivity in neuronal cells.
REXO2 Antibody - BSA Free Immunohistochemistry-Paraffin: REXO2 Antibody - BSA Free [NBP1-85666]

Immunohistochemistry-Paraffin: REXO2 Antibody - BSA Free [NBP1-85666]

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
REXO2 Antibody - BSA Free Immunohistochemistry-Paraffin: REXO2 Antibody - BSA Free [NBP1-85666]

Immunohistochemistry-Paraffin: REXO2 Antibody - BSA Free [NBP1-85666]

Staining of human colon shows strong cytoplasmic positivity in glandular cells.
REXO2 Antibody - BSA Free Immunohistochemistry-Paraffin: REXO2 Antibody - BSA Free [NBP1-85666]

Immunohistochemistry-Paraffin: REXO2 Antibody - BSA Free [NBP1-85666]

Staining of human parathyroid gland shows strong cytoplasmic positivity in glandular cells.
REXO2 Antibody - BSA Free Immunohistochemistry-Paraffin: REXO2 Antibody - BSA Free [NBP1-85666]

Immunohistochemistry-Paraffin: REXO2 Antibody - BSA Free [NBP1-85666]

Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Applications for REXO2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: REXO2

REXO2, also known as Oligoribonuclease, mitochondrial, is a 27kDa 237 amino acid protein with a shorter 23kDa 199 isoform. This gene plays a significant role in reparing DNA and is believed to play a role in aiding cells resist UV-C-induced death. REXO2 has been studied in relation to t-cell leukemia, leukemia, tuberculosis and mycobacterium tuberculosis. REXO2 is linked to the ribosome biogenesis in eukaryotes pathway where it interacts with ATG5, MPG, DIS3, UBC and EXOSC10.

Alternate Names

CGI-114, DKFZp566E144, EC 3.1, oligoribonuclease, mitochondrial, REX2, REX2, RNA exonuclease 2 homolog (S. cerevisiae), RFN, RNA exonuclease 2 homolog, SFNMGC111570, Small fragment nuclease, SMFN

Gene Symbol

REXO2

Additional REXO2 Products

Product Documents for REXO2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for REXO2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for REXO2 Antibody - BSA Free

Customer Reviews for REXO2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review REXO2 Antibody - BSA Free and earn rewards!

Have you used REXO2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies