RFC4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38162

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 204-363 of human RFC4 (NP_002907.1).

Sequence:
DKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RFC4 Antibody - BSA Free

RFC4 Antibody

Immunocytochemistry/ Immunofluorescence: RFC4 Antibody [NBP3-38162] -

Immunocytochemistry/ Immunofluorescence: RFC4 Antibody [NBP3-38162] - Immunofluorescence analysis of U2OS cells using RFC4 Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
RFC4 Antibody

Immunoprecipitation: RFC4 Antibody [NBP3-38162] -

Immunoprecipitation: RFC4 Antibody [NBP3-38162] - Immunoprecipitation analysis of 200 ug extracts of K562 cells using RFC4 antibody. Western blot was performed from the immunoprecipitate using RFC4 antibody at a dilution of 1:1000.
RFC4 Antibody

Western Blot: RFC4 Antibody [NBP3-38162] -

Western Blot: RFC4 Antibody [NBP3-38162] - Western blot analysis of various lysates using RFC4 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
RFC4 Antibody

Immunocytochemistry/ Immunofluorescence: RFC4 Antibody [NBP3-38162] -

Immunocytochemistry/ Immunofluorescence: RFC4 Antibody [NBP3-38162] - Immunofluorescence analysis of U2OS cells using RFC4 Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for RFC4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RFC4

The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported.

Alternate Names

A1, A1 37 kDa subunit, Activator 1 37 kDa subunit, Activator 1 subunit 4, MGC27291, replication factor C (activator 1) 4, 37kDa, Replication factor C 37 kDa subunit, replication factor C subunit 4, RFC 37 kDa subunit, RF-C 37 kDa subunit, RFC37replication factor C (activator 1) 4 (37kD)

Gene Symbol

RFC4

Additional RFC4 Products

Product Documents for RFC4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RFC4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RFC4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RFC4 Antibody - BSA Free and earn rewards!

Have you used RFC4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...