RFX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17759

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DASYTASAIRSSTYSYPETPLYTQTASTSYYEAAGTATQVSTPATSQAVASSGSMPMYVSGSQV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RFX1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RFX1 Antibody [NBP3-17759]

Immunocytochemistry/ Immunofluorescence: RFX1 Antibody [NBP3-17759]

Immunocytochemistry/Immunofluorescence: RFX1 Antibody [NBP3-17759] - Staining of human cell line PC-3 shows localization to nucleoplasm.
RFX1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: RFX1 Antibody - BSA Free [NBP3-17759]

Chromatin Immunoprecipitation-exo-Seq: RFX1 Antibody - BSA Free [NBP3-17759]

ChIP-Exo-Seq composite graph for Anti-RFX1 (NBP3-17759) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for RFX1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RFX1

RFX1, also known as MHC class II regulatory factor RFX1, is a 105 kDa 979 amino acid protein found in the nucleus. The gene plays a significant role in the gene expression of MHC class II. Current research on RFX1 is being conducted in relation to hepatitis, leukemia, neuroblastoma, sickle cell anemia and adenocarcinoma. RFX1 has been linked to the methlation, immune response, spermatogenesis and localization pathways where it interacts with TADA3, SMAD1, HDAC1, ADD1 and SMAD9.

Alternate Names

EFC, EF-C, Enhancer factor C, MHC class II regulatory factor RFX, MHC class II regulatory factor RFX1, Regulatory factor X 1, regulatory factor X, 1 (influences HLA class II expression), RFX, trans-acting regulatory factor 1, Transcription factor RFX1

Gene Symbol

RFX1

Additional RFX1 Products

Product Documents for RFX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RFX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RFX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RFX1 Antibody - BSA Free and earn rewards!

Have you used RFX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...