RFXAP Antibody (1B5) - Azide and BSA Free

Novus Biologicals | Catalog # H00005994-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1B5

Format

Azide and BSA Free
View all RFXAP Primary Antibodies »

Product Specifications

Immunogen

RFXAP (NP_000529, 179 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEV

Specificity

RFXAP - regulatory factor X-associated protein (1B5)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for RFXAP Antibody (1B5) - Azide and BSA Free

Western Blot: RFXAP Antibody (1B5) [H00005994-M01]

Western Blot: RFXAP Antibody (1B5) [H00005994-M01]

Western Blot: RFXAP Antibody (1B5) [H00005994-M01] - Analysis of RFXAP expression in transfected 293T cell line by RFXAP monoclonal antibody (M01), clone 1B5.Lane 1: RFXAP transfected lysate (Predicted MW: 28.3 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: RFXAP Antibody (1B5) [H00005994-M01] - Detection limit for recombinant GST tagged RFXAP is approximately 3ng/ml as a capture antibody.

Applications for RFXAP Antibody (1B5) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
It has been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: RFXAP

Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated ankyrin-containing protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group D. Transcript variants utilizing different polyA signals have been found for this gene. [provided by RefSeq]

Alternate Names

regulatory factor X-associated protein, RFX DNA-binding complex 36 kDa subunit, RFX-associated protein

Entrez Gene IDs

5994 (Human)

Gene Symbol

RFXAP

UniProt

NP_000529 (Human)

Additional RFXAP Products

Product Documents for RFXAP Antibody (1B5) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RFXAP Antibody (1B5) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RFXAP Antibody (1B5) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RFXAP Antibody (1B5) - Azide and BSA Free and earn rewards!

Have you used RFXAP Antibody (1B5) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies