RG9MTD1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-83654
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Knockdown Validated
Cited:
Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEECVSTISSSKDEDPLAATR
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for RG9MTD1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: RG9MTD1 Antibody [NBP1-83654]
Immunocytochemistry/Immunofluorescence: RG9MTD1 Antibody [NBP1-83654] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.Immunoprecipitation: RG9MTD1 Antibody [NBP1-83654]
RG9MTD1-Antibody-Immunoprecipitation-NBP1-83654-img0010.jpgImmunoprecipitation: RG9MTD1 Antibody [NBP1-83654] -
Immunoprecipitation: RG9MTD1 Antibody [NBP1-83654] - P32 can be co-immunoprecipitated with mitochondrial RNase P protein.(A) RT-PCR assay for the mRNA levels of P32 or MRPP1 in siRNA treated HeLa cells. The error bars represent standard deviation of three replicates. (B) Northern hybridization for mitochondrial pre-rRNA. Total RNA prepared from HeLa cells pre-treated for 24 hrs with P32 [(−)P32] or MRPP1 [(−)MRPP1] siRNAs was analyzed by northern hybridization, using probes specific to pre-rRNA, as in Figure 5.The same blot was re-probed for 7 SL RNA, which served as a loading control. (C) Immunoprecipitation using MRPP1 antibody (MRPP1-AB) or RPL5 antibody (RPL5-AB) was performed as described in materials & methods. Co-isolated proteins were separated by SDS-PAGE, & P32 protein was determined by western analysis. (−)AB, control immunoprecipitation in the absence of antibody. (D) DNase I treatment disrupted the P32-MRPP1 interaction. Immunoprecipitation was performed using MRPP1 antibody, as in panel C. After wash, the beads were incubated with either RNase A or DNase I, to elute bound materials. The eluted proteins were analyzed by western blots for the presence of P32 protein. Buffer, 1×TE buffer alone. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/23990920), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry-Paraffin: RG9MTD1 Antibody - BSA Free [NBP1-83654]
Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.Western Blot: RG9MTD1 Antibody - BSA Free [NBP1-83654]
Analysis in A-431 cells) transfected with control siRNA, target specific siRNA probe #1, using Anti-TRMT10C antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.Applications for RG9MTD1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunoprecipitation reported in scientific literature (PMID 23990920)
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RG9MTD1
Alternate Names
EC 2.1.1, EC 2.1.1.-, EC 2.1.1.36, FLJ20432, HBV pre-S2 trans-regulated protein 2, Mitochondrial RNase P protein 1, MRPP1mitochondrial ribonuclease P protein 1, NY-REN-49 antigen, Renal carcinoma antigen NY-REN-49, RNA (guanine-9-) methyltransferase domain containing 1, RNA (guanine-9-)-methyltransferase domain-containing protein 1
Gene Symbol
TRMT10C
Additional RG9MTD1 Products
Product Documents for RG9MTD1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RG9MTD1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RG9MTD1 Antibody - BSA Free
Customer Reviews for RG9MTD1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review RG9MTD1 Antibody - BSA Free and earn rewards!
Have you used RG9MTD1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...