RGS16 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55382

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RGS16 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RGS16 (regulator of G-protein signalling 16) The peptide sequence was selected from the C terminal of RGS16. Peptide sequence DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RGS16 Antibody - BSA Free

Western Blot: RGS16 Antibody [NBP1-55382]

Western Blot: RGS16 Antibody [NBP1-55382]

Western Blot: RGS16 Antibody [NBP1-55382] - Jurkat cell lysate, concentration 1.0ug/ml.

Applications for RGS16 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RGS16

RGS16 belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade.

Alternate Names

A28-RGS14, A28-RGS14P, hRGS-r, regulator of G-protein signaling 16, regulator of G-protein signalling 16, Retinally abundant regulator of G-protein signaling, Retinal-specific RGS, RGSR, RGS-R

Gene Symbol

RGS16

UniProt

Q5VYN9 (Human)

Additional RGS16 Products

Product Documents for RGS16 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RGS16 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RGS16 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RGS16 Antibody - BSA Free and earn rewards!

Have you used RGS16 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies