RGS18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-76522

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RGS18 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIW

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84)% and Rat (88)%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RGS18 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RGS18 Antibody [NBP2-76522]

Immunocytochemistry/ Immunofluorescence: RGS18 Antibody [NBP2-76522]

Immunocytochemistry/Immunofluorescence: RGS18 Antibody [NBP2-76522] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.

Applications for RGS18 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RGS18

Regulators of G-protein signaling (RGSs) are a protein family that can act as GTPase-activating proteins for G(alphai)- and G(alphaq)-class proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination. One of these proteins, RGS18, is a 235 amino acid protein that is closely related to RGS5 (46% identity) and approximately 30-40% identity to other RGS proteins. This protein is expressed in platelet, leukocyte, and megakaryocyte cell lines. Engagement of TLR3 or TLR4 on monocyte-derived DCs potently down-regulates RGS18 and RGS14 without modifying other RGS proteins. A similar pattern of RGS protein expression occurs in immature bone marrow-derived mouse DCs stimulated to mature via TLR4 signaling. The changes in RGS18 and RGS1 expression are likely important for DC function.

Alternate Names

regulator of G-protein signaling 18, regulator of G-protein signalling 13, RGS13regulator of G-protein signalling 18

Gene Symbol

RGS18

Additional RGS18 Products

Product Documents for RGS18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RGS18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RGS18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RGS18 Antibody - BSA Free and earn rewards!

Have you used RGS18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies