RHBDL2 Antibody (2H1) - Azide and BSA Free

Novus Biologicals | Catalog # H00054933-M02

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 2H1

Format

Azide and BSA Free
View all RHBDL2 Primary Antibodies »

Product Specifications

Immunogen

RHBDL2 (NP_060291.2, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPP

Specificity

RHBDL2 - rhomboid, veinlet-like 2 (Drosophila) (2H1)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images for RHBDL2 Antibody (2H1) - Azide and BSA Free

Sandwich ELISA: RHBDL2 Antibody (2H1) [H00054933-M02] - Detection limit for recombinant GST tagged RHBDL2 is 0.1 ng/ml as a capture antibody.

Applications for RHBDL2 Antibody (2H1) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: RHBDL2

The protein encoded by this gene is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. The encoded protein is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3. [provided by RefSeq]

Alternate Names

EC 3.4.21.105, FLJ20435, MGC16997, rhomboid (veinlet, Drosophila)-like 2, rhomboid protease 2, rhomboid, veinlet-like 2 (Drosophila), Rhomboid-like protein 2, rhomboid-related protein 2, RRP2

Entrez Gene IDs

54933 (Human)

Gene Symbol

RHBDL2

UniProt

NP_060291 (Human)

Additional RHBDL2 Products

Product Documents for RHBDL2 Antibody (2H1) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RHBDL2 Antibody (2H1) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RHBDL2 Antibody (2H1) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RHBDL2 Antibody (2H1) - Azide and BSA Free and earn rewards!

Have you used RHBDL2 Antibody (2H1) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies