RhoG Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79794

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human RHOGThe immunogen for this antibody is RHOG. Peptide sequence LVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RhoG Antibody - BSA Free

Western Blot: RhoG Antibody [NBP1-79794]

Western Blot: RhoG Antibody [NBP1-79794]

Western Blot: RhoG Antibody [NBP1-79794] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: RhoG Antibody [NBP1-79794]

Immunohistochemistry: RhoG Antibody [NBP1-79794]

Immunohistochemistry: RhoG Antibody [NBP1-79794] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Plasma membrane in intercalated disk Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Applications for RhoG Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RhoG

RhoG, also known as Rho-related GTP-binding protein RhoG, is a 21kDa 191 amino acid protein. RhoG plays a significant part in cell migration. RhoG has been researched in relation to Tangier disease, intrahepatic cholangiocarcinoma, shigellosis, cholangiocarcinoma, cholesterol and thyroiditis. RhoG has been linked to the axon guidance, cell adhesion, phagocytosis, cell motility and cell growth pathways where it interacts with VAV1, VAV2, ELMO1, MAP3K11 and ARHGDIG.

Alternate Names

ARHGMGC125835, MGC125836, ras homolog gene family, member G (rho G), RhoG, rho-related GTP-binding protein RhoG

Gene Symbol

RHOG

Additional RhoG Products

Product Documents for RhoG Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RhoG Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RhoG Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RhoG Antibody - BSA Free and earn rewards!

Have you used RhoG Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...