RhoGDI Antibody (0D6X5)

Novus Biologicals | Catalog # NBP3-15401

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0D6X5 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RhoGDI (P52565). VVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RhoGDI Antibody (0D6X5)

Western Blot: RhoGDI Antibody (0D6X5) [NBP3-15401]

Western Blot: RhoGDI Antibody (0D6X5) [NBP3-15401]

Western Blot: RhoGDI Antibody (0D6X5) [NBP3-15401] - Western blot analysis of extracts of various cell lines, using RhoGDI Rabbit mAb (NBP3-15401) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Knockout Validated: RhoGDI Antibody (0D6X5) [NBP3-15401]

Western Blot: RhoGDI Antibody (0D6X5) [NBP3-15401]

Western Blot: RhoGDI Antibody (0D6X5) [NBP3-15401] - Western blot analysis of extracts from normal (control) and RhoGDI knockout (KO) 293T cells, using RhoGDI antibody (NBP3-15401) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Applications for RhoGDI Antibody (0D6X5)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RhoGDI

Aplysia Ras-related homologs (ARHs), also called Rho genes, belong to the RAS gene superfamily encoding small guanine nucleotide exchange (GTP/GDP) factors. The ARH proteins may be kept in the inactive, GDP-bound state by interaction with GDP dissociation inhibitors, such as ARHGDIA (Leffers et al., 1993 [PubMed 8262133]).[supplied by OMIM]

Alternate Names

GDIA1, MGC117248, Rho GDI 1, Rho GDP dissociation inhibitor (GDI) alpha, rho GDP-dissociation inhibitor 1, RHOGDI, Rho-GDI alpha, RHOGDI-1

Gene Symbol

ARHGDIA

Additional RhoGDI Products

Product Documents for RhoGDI Antibody (0D6X5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RhoGDI Antibody (0D6X5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RhoGDI Antibody (0D6X5)

There are currently no reviews for this product. Be the first to review RhoGDI Antibody (0D6X5) and earn rewards!

Have you used RhoGDI Antibody (0D6X5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...