RNA Helicase A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57334

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RNA Helicase A Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DHX9(DEAH (Asp-Glu-Ala-His) box polypeptide 9) The peptide sequence was selected from the N terminal of DHX9. Peptide sequence GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RNA Helicase A Antibody - BSA Free

Western Blot: RNA Helicase A Antibody [NBP1-57334]

Western Blot: RNA Helicase A Antibody [NBP1-57334]

Western Blot: RNA Helicase A Antibody [NBP1-57334] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: RNA Helicase A Antibody [NBP1-57334]

Immunohistochemistry-Paraffin: RNA Helicase A Antibody [NBP1-57334]

Immunohistochemistry-Paraffin: RNA Helicase A Antibody [NBP1-57334] - Human Pancrease (Epithelial cells of acinus indicated with arrows), 4-8ug/ml.

Applications for RNA Helicase A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RNA Helicase A

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity.

Long Name

ATP-dependent RNA helicase A

Alternate Names

DDX9, DEAH box protein 9, DExH-box helicase 9, DHX9, EC 3.6.4.13, Leukophysin, LKP, NDH II, NDH2

Gene Symbol

DHX9

Additional RNA Helicase A Products

Product Documents for RNA Helicase A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RNA Helicase A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RNA Helicase A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RNA Helicase A Antibody - BSA Free and earn rewards!

Have you used RNA Helicase A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies