RNF25 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32664

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ECHAPKGTRDTQELPPPEGPLKEPMDLKPEPHSQGVEGPPQEKGPGSWQGPPPRRTRDCVRWERSKGRTPGSSYPR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RNF25 Antibody - BSA Free

Western Blot: RNF25 Antibody [NBP2-32664]

Western Blot: RNF25 Antibody [NBP2-32664]

Western Blot: RNF25 Antibody [NBP2-32664] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-482
Immunocytochemistry/ Immunofluorescence: RNF25 Antibody [NBP2-32664]

Immunocytochemistry/ Immunofluorescence: RNF25 Antibody [NBP2-32664]

Immunocytochemistry/Immunofluorescence: RNF25 Antibody [NBP2-32664] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry: RNF25 Antibody [NBP2-32664]

Immunohistochemistry: RNF25 Antibody [NBP2-32664]

Immunohistochemistry: RNF25 Antibody [NBP2-32664] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Applications for RNF25 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RNF25

RING finger protein 25 (RNF25, also named AO7) contains a RING finger domain and is ubiquitously expressed in various tissues. RNF25 was initially identified in a yeast two-hybrid screen of a murine T-cell library by using UbcH5b, an E2 enzyme, as bait. RNF25 has also been shown to act as a putative E3 ligase, at least in vitro. RNF25 localizes predominantly in the nucleus and supports the transcriptional activity of NF-kB by interacting with p65 in vivo upon stimulation with TNF. Yeast two-hybrid data also suggest that RNF25 interacts with a number of other molecules which may be potential ubiquitin ligase substrates. Among these are molecules that have critical roles in signal transduction and in regulation of translation (personal communication, Allan Weissman, CCR-NCI, Bethesda, MD).

Alternate Names

AO7, EC 6.3.2.-, FLJ13906, ring finger protein 25E3 ubiquitin-protein ligase RNF25, ring finger protein AO7

Gene Symbol

RNF25

Additional RNF25 Products

Product Documents for RNF25 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RNF25 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RNF25 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RNF25 Antibody - BSA Free and earn rewards!

Have you used RNF25 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...