RNPS1 Antibody (7G8) - Azide and BSA Free

Novus Biologicals | Catalog # H00010921-M05

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Western Blot, ELISA, Immunoprecipitation

Cited:

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 7G8

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

RNPS1 (NP_006702, 158 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL

Specificity

RNPS1 - RNA binding protein S1, serine-rich domain (7G8)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for RNPS1 Antibody (7G8) - Azide and BSA Free

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in rat testis.
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in HeLa.
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in PC-12.
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in 293.
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in Raw 264.7.
Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05]

Western Blot: RNPS1 Antibody (7G8) [H00010921-M05] - Analysis of RNPS1 expression in human kidney.

Applications for RNPS1 Antibody (7G8) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Use in immunprecipitation reported in scientific literature (PMID 22672905)

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: RNPS1

This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. This protein contains many serine residues. Two splice variants have been found for this gene; both variants encode the same protein.

Alternate Names

E5.1, LDC2, MGC117332, RNA binding protein S1, serine-rich domain, RNA-binding protein S1, serine-rich domain, RNA-binding protein with serine-rich domain 1, SR protein, SR-related protein LDC2

Entrez Gene IDs

10921 (Human)

Gene Symbol

RNPS1

Additional RNPS1 Products

Product Documents for RNPS1 Antibody (7G8) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RNPS1 Antibody (7G8) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RNPS1 Antibody (7G8) - Azide and BSA Free

Customer Reviews for RNPS1 Antibody (7G8) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RNPS1 Antibody (7G8) - Azide and BSA Free and earn rewards!

Have you used RNPS1 Antibody (7G8) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...