RPL18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13251

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: KLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERAR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPL18 Antibody - BSA Free

Western Blot: RPL18 Antibody [NBP2-13251]

Western Blot: RPL18 Antibody [NBP2-13251]

Western Blot: RPL18 Antibody [NBP2-13251] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: RPL18 Antibody [NBP2-13251]

Immunocytochemistry/ Immunofluorescence: RPL18 Antibody [NBP2-13251]

Immunocytochemistry/Immunofluorescence: RPL18 Antibody [NBP2-13251] - Staining of human cell line HEK 293 shows localization to nucleoli, cytosol & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RPL18 Antibody [NBP2-13251]

Immunohistochemistry-Paraffin: RPL18 Antibody [NBP2-13251]

Immunohistochemistry-Paraffin: RPL18 Antibody [NBP2-13251] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
RPL18 Antibody - BSA Free Western Blot: RPL18 Antibody - BSA Free [NBP2-13251]

Western Blot: RPL18 Antibody - BSA Free [NBP2-13251]

Analysis in human cell line HEK 293.
RPL18 Antibody - BSA Free Immunohistochemistry: RPL18 Antibody - BSA Free [NBP2-13251]

Immunohistochemistry: RPL18 Antibody - BSA Free [NBP2-13251]

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
RPL18 Antibody - BSA Free Immunohistochemistry: RPL18 Antibody - BSA Free [NBP2-13251]

Immunohistochemistry: RPL18 Antibody - BSA Free [NBP2-13251]

Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
RPL18 Antibody - BSA Free Immunohistochemistry: RPL18 Antibody - BSA Free [NBP2-13251]

Immunohistochemistry: RPL18 Antibody - BSA Free [NBP2-13251]

Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.
RPL18 Antibody - BSA Free Immunohistochemistry: RPL18 Antibody - BSA Free [NBP2-13251]

Immunohistochemistry: RPL18 Antibody - BSA Free [NBP2-13251]

Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Applications for RPL18 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPL18

RPL18, also known as Ribosomal Protein L18, is a component of the large 60S subunit of ribosomes. RPL18 is 188 amino acids in length and is approximately 21kDa. Current research on RPL18 has shown a possible link with breast cancer, malaria, Treacher Collins syndrome and Fanconi anemia. RPL18 has also been shown to interact with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D and HIST1H4E.

Alternate Names

ribosomal protein L18,60S ribosomal protein L18

Gene Symbol

RPL18

Additional RPL18 Products

Product Documents for RPL18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPL18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPL18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPL18 Antibody - BSA Free and earn rewards!

Have you used RPL18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...