RPL18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88185

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RPL18 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RPL18. Peptide sequence: MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RPL18 Antibody - BSA Free

Western Blot: RPL18 Antibody [NBP2-88185]

Western Blot: RPL18 Antibody [NBP2-88185]

Western Blot: RPL18 Antibody [NBP2-88185] - WB Suggested Anti-RPL18 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: HT1080 cell lysateRPL18 is supported by BioGPS gene expression data to be expressed in HT1080
Immunohistochemistry-Paraffin: RPL18 Antibody [NBP2-88185]

Immunohistochemistry-Paraffin: RPL18 Antibody [NBP2-88185]

Immunohistochemistry-Paraffin: RPL18 Antibody [NBP2-88185] - Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver. Observed Staining: Cytoplasm in hepatocytes, very strong signal, low tissue distribution. Primary Antibody Concentration: 1:100.

Applications for RPL18 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPL18

RPL18, also known as Ribosomal Protein L18, is a component of the large 60S subunit of ribosomes. RPL18 is 188 amino acids in length and is approximately 21kDa. Current research on RPL18 has shown a possible link with breast cancer, malaria, Treacher Collins syndrome and Fanconi anemia. RPL18 has also been shown to interact with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D and HIST1H4E.

Alternate Names

ribosomal protein L18,60S ribosomal protein L18

Gene Symbol

RPL18

Additional RPL18 Products

Product Documents for RPL18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPL18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPL18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPL18 Antibody - BSA Free and earn rewards!

Have you used RPL18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies