RPL24/RLP24 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35776

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RPL24/RLP24 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 10-80 of human RPL24/RLP24 (NP_057388.1).

Sequence:
SGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RPL24/RLP24 Antibody - BSA Free

RPL24/RLP24 Antibody

Western Blot: RPL24/RLP24 Antibody [NBP3-35776] -

Western Blot: RPL24/RLP24 Antibody [NBP3-35776] - Western blot analysis of various lysates using RPL24/RLP24 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3min.

Applications for RPL24/RLP24 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RPL24/RLP24

RPL24/RLP24 encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although RPL24/RLP24 has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The protein encoded by this gene localizes to the nucleolus and is thought to play a role in the biogenesis of the 60S ribosomal subunit. The precise function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals and has multiple pseudogenes. [provided by RefSeq, Jul 2012]

Alternate Names

C15orf15, HRP-L30-iso, L30, RLP24, RPL24, RPL24L, RSL24D1 ribosomal L24 domain containing 1, TVAS3

Gene Symbol

RSL24D1

Additional RPL24/RLP24 Products

Product Documents for RPL24/RLP24 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RPL24/RLP24 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPL24/RLP24 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPL24/RLP24 Antibody - BSA Free and earn rewards!

Have you used RPL24/RLP24 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies