RPS3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38024

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPS3 Antibody - BSA Free

Western Blot: RPS3 Antibody [NBP2-38024]

Western Blot: RPS3 Antibody [NBP2-38024]

Western Blot: RPS3 Antibody [NBP2-38024] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: RPS3 Antibody [NBP2-38024]

Immunocytochemistry/ Immunofluorescence: RPS3 Antibody [NBP2-38024]

Immunocytochemistry/Immunofluorescence: RPS3 Antibody [NBP2-38024] - Staining of human cell line MCF7 shows localization to cytosol & endoplasmic reticulum.
Immunohistochemistry: RPS3 Antibody [NBP2-38024]

Immunohistochemistry: RPS3 Antibody [NBP2-38024]

Immunohistochemistry: RPS3 Antibody [NBP2-38024] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.
Immunocytochemistry/ Immunofluorescence: RPS3 Antibody [NBP2-38024]

Immunocytochemistry/ Immunofluorescence: RPS3 Antibody [NBP2-38024]

Immunocytochemistry/Immunofluorescence: RPS3 Antibody [NBP2-38024] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol & endoplasmic reticulum.

Applications for RPS3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPS3

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit, where it forms part of the domain where translation is initiated. The protein belongs to the S3P family of ribosomal proteins. Studies of the mouse and rat proteins have demonstrated that the protein has an extraribosomal role as an endonuclease involved in the repair of UV-induced DNA damage. The protein appears to be located in both the cytoplasm and nucleus but not in the nucleolus. Higher levels of expression of this gene in colon adenocarcinomas and adenomatous polyps compared to adjacent normal colonic mucosa have been observed. This gene is co-transcribed with the small nucleolar RNA genes U15A and U15B, which are located in its first and fifth introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]

Alternate Names

40S ribosomal protein S3, FLJ26283, FLJ27450, IMR-90 ribosomal protein S3, MGC87870, ribosomal protein S3

Gene Symbol

RPS3

UniProt

Additional RPS3 Products

Product Documents for RPS3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPS3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPS3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPS3 Antibody - BSA Free and earn rewards!

Have you used RPS3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...