RRP4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35142

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RRP4 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-293 of human RRP4 (NP_055100.2).

Sequence:
MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RRP4 Antibody - BSA Free

RRP4 Antibody

Western Blot: RRP4 Antibody [NBP3-35142] -

Western Blot: RRP4 Antibody [NBP3-35142] - Western blot analysis of various lysates using RRP4 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.
RRP4 Antibody

Immunocytochemistry/ Immunofluorescence: RRP4 Antibody [NBP3-35142] -

Immunocytochemistry/ Immunofluorescence: RRP4 Antibody [NBP3-35142] - Immunofluorescence analysis of H9C2 cells using RRP4 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
RRP4 Antibody

Immunocytochemistry/ Immunofluorescence: RRP4 Antibody [NBP3-35142] -

Immunocytochemistry/ Immunofluorescence: RRP4 Antibody [NBP3-35142] - Immunofluorescence analysis of U2OS cells using RRP4 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
RRP4 Antibody

Immunocytochemistry/ Immunofluorescence: RRP4 Antibody [NBP3-35142] -

Immunocytochemistry/ Immunofluorescence: RRP4 Antibody [NBP3-35142] - Immunofluorescence analysis of L929 cells using RRP4 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for RRP4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RRP4

EXOSC2 - exosome component 2

Alternate Names

exosome component 2Ribosomal RNA-processing protein 4, homolog of yeast RRP4 (ribosomal RNA processing 4), 3' 5' exoribonuclease(RRP4), homolog of yeast RRP4 (ribosomal RNA processing 4), 3'-5'-exoribonuclease, hRrp4p, p7, RRP4exosome complex exonuclease RRP4, Rrp4p

Gene Symbol

EXOSC2

Additional RRP4 Products

Product Documents for RRP4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RRP4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RRP4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RRP4 Antibody - BSA Free and earn rewards!

Have you used RRP4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies