Reticulon-1 (RTN1) is multi-pass membrane protein that is a member of a family of conserved proteins that are primarily located in the endoplasmic reticulum (ER) and play a role in promoting membrane curvature. Reticulons (RTN1-4) share a conserved reticulon homology domain in their C-terminus, which is important for the localization of RTNs in the ER as they do not contain the canonical N-terminal ER-localization signal. Alternative splicing of the human gene generates two major isoforms, RTN1-A and RTN1-C, and, to a lesser extent, a third variant termed RTN1-B. The canonical isoform, RTN1-A, also known as Neuroendocrine-specific Protein (NSP), is 776 amino acids (aa) in length with a predicted molecular weight of approximately 135 kDa. RTN1-C lacks aa 1-568 and contains a 20 aa substitution for aa 569-588. RTN1-B lacks aa 1-420. Human RTN1-A/NSP shares 82% aa sequence identity with the rat ortholog. RTN1 is widely expressed in neurons in the developing and mature brain, as well as in neuroendocrine tissue. It is suggested to play a role in neuronal differentiation and DNA binding/epigenetic modifications. RTN1-A/NSP has been shown to form a stable association with the ryanodine receptor RyR2 and modify RyR2-mediated calcium signaling. Research has also shown that RTN1-A/NSP may also function as a potential growth cone marker in elongating neurons.
RTN1-A/NSP Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-58934
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AYKYIDITRPEEVKHQEQHHPELEDKDLDFKNKDTDISIKPEGVREPDKPAPVEGKIIKDHLLEESTFAPYIDDLSEEQRRAPQITTPV
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for RTN1-A/NSP Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: RTN1-A/NSP Antibody [NBP2-58934]
Immunocytochemistry/Immunofluorescence: RTN1 Antibody [NBP2-58934] - Staining of human cell line U-2 OS shows localization to nuclear bodies & endoplasmic reticulum.Applications for RTN1-A/NSP Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RTN1-A/NSP
Long Name
Reticulon 1A/Neuroendocrine-specific Protein
Alternate Names
NSP-A, RTN1, RTN1A
Gene Symbol
RTN1
Additional RTN1-A/NSP Products
Product Documents for RTN1-A/NSP Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RTN1-A/NSP Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for RTN1-A/NSP Antibody - BSA Free
There are currently no reviews for this product. Be the first to review RTN1-A/NSP Antibody - BSA Free and earn rewards!
Have you used RTN1-A/NSP Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...