RTN1-A/NSP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58934

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AYKYIDITRPEEVKHQEQHHPELEDKDLDFKNKDTDISIKPEGVREPDKPAPVEGKIIKDHLLEESTFAPYIDDLSEEQRRAPQITTPV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RTN1-A/NSP Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RTN1-A/NSP Antibody [NBP2-58934]

Immunocytochemistry/ Immunofluorescence: RTN1-A/NSP Antibody [NBP2-58934]

Immunocytochemistry/Immunofluorescence: RTN1 Antibody [NBP2-58934] - Staining of human cell line U-2 OS shows localization to nuclear bodies & endoplasmic reticulum.

Applications for RTN1-A/NSP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RTN1-A/NSP

Reticulon-1 (RTN1) is multi-pass membrane protein that is a member of a family of conserved proteins that are primarily located in the endoplasmic reticulum (ER) and play a role in promoting membrane curvature. Reticulons (RTN1-4) share a conserved reticulon homology domain in their C-terminus, which is important for the localization of RTNs in the ER as they do not contain the canonical N-terminal ER-localization signal. Alternative splicing of the human gene generates two major isoforms, RTN1-A and RTN1-C, and, to a lesser extent, a third variant termed RTN1-B. The canonical isoform, RTN1-A, also known as Neuroendocrine-specific Protein (NSP), is 776 amino acids (aa) in length with a predicted molecular weight of approximately 135 kDa. RTN1-C lacks aa 1-568 and contains a 20 aa substitution for aa 569-588. RTN1-B lacks aa 1-420. Human RTN1-A/NSP shares 82% aa sequence identity with the rat ortholog. RTN1 is widely expressed in neurons in the developing and mature brain, as well as in neuroendocrine tissue. It is suggested to play a role in neuronal differentiation and DNA binding/epigenetic modifications. RTN1-A/NSP has been shown to form a stable association with the ryanodine receptor RyR2 and modify RyR2-mediated calcium signaling. Research has also shown that RTN1-A/NSP may also function as a potential growth cone marker in elongating neurons.

Long Name

Reticulon 1A/Neuroendocrine-specific Protein

Alternate Names

NSP-A, RTN1, RTN1A

Gene Symbol

RTN1

Additional RTN1-A/NSP Products

Product Documents for RTN1-A/NSP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RTN1-A/NSP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for RTN1-A/NSP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RTN1-A/NSP Antibody - BSA Free and earn rewards!

Have you used RTN1-A/NSP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...