S100A11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03232

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human

Applications

Knockout Validated, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all S100A11 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1). MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for S100A11 Antibody - BSA Free

Western Blot: S100A11 AntibodyBSA Free [NBP3-03232]

Western Blot: S100A11 AntibodyBSA Free [NBP3-03232]

Western Blot: S100A11 Antibody [NBP3-03232] - Analysis of extracts of various cell lines, using S100A11 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.
Immunocytochemistry/ Immunofluorescence: S100A11 Antibody - BSA Free [NBP3-03232]

Immunocytochemistry/ Immunofluorescence: S100A11 Antibody - BSA Free [NBP3-03232]

Immunocytochemistry/Immunofluorescence: S100A11 Antibody [NBP3-03232] - Analysis of U2OS cells using S100A11 antibody. Blue: DAPI for nuclear staining.
Knockout Validated: S100A11 Antibody - BSA Free [NBP3-03232]

Western Blot: S100A11 Antibody - BSA Free [NBP3-03232]

Western Blot: S100A11 Antibody [NBP3-03232] - Analysis of extracts from normal (control) and S100A11 knockout (KO) HeLa cells, using S100A11 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Immunoprecipitation: S100A11 Antibody - BSA Free [NBP3-03232]

Immunoprecipitation: S100A11 Antibody - BSA Free [NBP3-03232]

Immunoprecipitation: S100A11 Antibody [NBP3-03232] - Immunoprecipitation analysis of 200ug extracts of THP-1 cells using 3ug S100A11 antibody (NBP3-03232). Western blot was performed from the immunoprecipitate using S100A11 antibody (NBP3-03232) at a dilution of 1:1000.

Applications for S100A11 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: S100A11

S100A11 is encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.

Long Name

S100 Calcium Binding Protein A11

Alternate Names

Calgizzarin, MLN70, S100C

Gene Symbol

S100A11

Additional S100A11 Products

Product Documents for S100A11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for S100A11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for S100A11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review S100A11 Antibody - BSA Free and earn rewards!

Have you used S100A11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies