S100A5 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93842

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100A5 (NP_002953.2). METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for S100A5 Antibody - Azide and BSA Free

Western Blot: S100A5 AntibodyAzide and BSA Free [NBP2-93842]

Western Blot: S100A5 AntibodyAzide and BSA Free [NBP2-93842]

Western Blot: S100A5 Antibody [NBP2-93842] - Western blot analysis of extracts of U-251MG cells, using S100A5 Rabbit pAb (NBP2-93842) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.
Immunohistochemistry-Paraffin: S100A5 Antibody - Azide and BSA Free [NBP2-93842]

Immunohistochemistry-Paraffin: S100A5 Antibody - Azide and BSA Free [NBP2-93842]

Immunohistochemistry-Paraffin: S100A5 Antibody [NBP2-93842] - Paraffin-embedded human colon using S100A5.
Immunohistochemistry-Paraffin: S100A5 Antibody - Azide and BSA Free [NBP2-93842]

Immunohistochemistry-Paraffin: S100A5 Antibody - Azide and BSA Free [NBP2-93842]

Immunohistochemistry-Paraffin: S100A5 Antibody [NBP2-93842] - Paraffin-embedded human thyroid cancer using S100A5.

Applications for S100A5 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:100-1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: S100A5

S100A5 is encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions. This protein also binds Zn2+ and Cu2+, and Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the adult brain.

Alternate Names

Protein S-100D, S100 calcium binding protein A5, S100 calcium-binding protein A5S100Dprotein S100-A5

Gene Symbol

S100A5

Additional S100A5 Products

Product Documents for S100A5 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for S100A5 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for S100A5 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review S100A5 Antibody - Azide and BSA Free and earn rewards!

Have you used S100A5 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...