S100A9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89360

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: CKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for S100A9 Antibody - BSA Free

S100A9 Antibody - BSA Free Immunohistochemistry-Paraffin: S100A9 Antibody - BSA Free [NBP1-89360]

Immunohistochemistry-Paraffin: S100A9 Antibody - BSA Free [NBP1-89360]

Analysis in human esophagus and stomach tissues using NBP1-89360 antibody. Corresponding S100A9 RNA-seq data are presented for the same tissues.
S100A9 Antibody - BSA Free Immunohistochemistry-Paraffin: S100A9 Antibody - BSA Free [NBP1-89360]

Immunohistochemistry-Paraffin: S100A9 Antibody - BSA Free [NBP1-89360]

Staining of human esophagus shows moderate to strong cytoplasmic and nuclear positivity in squamous epithelial cells.
S100A9 Antibody - BSA Free Immunohistochemistry-Paraffin: S100A9 Antibody - BSA Free [NBP1-89360]

Immunohistochemistry-Paraffin: S100A9 Antibody - BSA Free [NBP1-89360]

Staining of human stomach shows no positivity in glandular cells as expected.
S100A9 Antibody - BSA Free Immunohistochemistry-Paraffin: S100A9 Antibody - BSA Free [NBP1-89360]

Immunohistochemistry-Paraffin: S100A9 Antibody - BSA Free [NBP1-89360]

Staining of human skin shows moderate to strong cytoplasmic and nuclear positivity in squamous epithelial cells.
S100A9 Antibody - BSA Free Immunohistochemistry-Paraffin: S100A9 Antibody - BSA Free [NBP1-89360]

Immunohistochemistry-Paraffin: S100A9 Antibody - BSA Free [NBP1-89360]

Staining of human bone marrow shows strong cytoplasmic positivity in a subset of hematopoietic cells.
Simple Western: S100A9 Antibody [NBP1-89360]

Simple Western: S100A9 Antibody [NBP1-89360]

Simple Western: S100A9 Antibody [NBP1-89360] - Electropherogram image(s) of corresponding Simple Western lane view. S100A9 antibody was used at 1:20 dilution on h. Tonsil lysate(s).
Simple Western: S100A9 Antibody [NBP1-89360]

Simple Western: S100A9 Antibody [NBP1-89360]

Simple Western: S100A9 Antibody [NBP1-89360] - Simple Western lane view shows a specific band for S100A9 in 0.2 mg/ml of h. Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
S100A9 Antibody - BSA Free Western Blot: S100A9 Antibody - BSA Free [NBP1-89360]

Western Blot: S100A9 Antibody - BSA Free [NBP1-89360]

Analysis in human cell line SK-BR-3.

Applications for S100A9 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:5000 - 1:10000

Immunohistochemistry-Paraffin

1:5000 - 1:10000

Simple Western

1:20

Western Blot

0.04-0.4 ug/ml
Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in h. Tonsil, separated by Size, antibody dilution of 1:20, apparent MW was 19 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: S100A9

S100A9 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and are involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A9 may function in the inhibition of casein kinase, and altered expression is associated with the disease cystic fibrosis. Overexpression of S100A9 has also recently been linked to a poor prognosis with invasive ductal carcinoma of the breast.

Long Name

S100 Calcium Binding Protein A9

Alternate Names

Calgranulin B, MRP-14

Gene Symbol

S100A9

Additional S100A9 Products

Product Documents for S100A9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for S100A9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for S100A9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review S100A9 Antibody - BSA Free and earn rewards!

Have you used S100A9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for S100A9 Antibody - BSA Free

Showing  1 - 2 of 2 FAQs Showing All
  • Q: Have any of your S100A9 antibodies been tested for use in neutralization, or blocking assays, on human samples?

    A: Unfortunately at this time we have not tested, or received customer feedback on our S100A9 antibodies for use in blocking or neutralizing assays. If you were planning on testing any of our S100A9 antibodies for neutralizing or blocking capabilities, we would recommend our Innovator’s Reward Program. Under the terms of this program we would be happy to provide a credit for a free vial in exchange for new data on this previously untested or reported application. Please submit this data in the form of an online review. Additional Innovators Reward Program information can be found using this link.

  • Q: We would like to stain paraffin embedded human intestinal tissue for Calprotectin. One question will be which cells express the majority of Calprotectin - invading neutrophils vs epithelium for example. The antibody list you provide is quite extensive. Which antibody would you recommend for our purpose? Which tissue would you recommend as positive control.

    A: Nine of our antibodies to Calprotectin have been validated for IHC-P with human tissue, and you can see all of these products. A number of our IHC images were generated using human spleen samples, and as such this may be a good choice of a positive control tissue. We do sell a human spleen slide product, which is suitable for IHC-P. Unfortunately I do not have an in-depth knowledge of Calprotectin, however the image shown for our antibody with catalogue number NBP1-02826 demonstrates clear staining of neutrophils. The following paper also suggests that the protein is abundant in neutrophils: PMID 11435495.

  • Q: Have any of your S100A9 antibodies been tested for use in neutralization, or blocking assays, on human samples?

    A: Unfortunately at this time we have not tested, or received customer feedback on our S100A9 antibodies for use in blocking or neutralizing assays. If you were planning on testing any of our S100A9 antibodies for neutralizing or blocking capabilities, we would recommend our Innovator’s Reward Program. Under the terms of this program we would be happy to provide a credit for a free vial in exchange for new data on this previously untested or reported application. Please submit this data in the form of an online review. Additional Innovators Reward Program information can be found using this link.

  • Q: We would like to stain paraffin embedded human intestinal tissue for Calprotectin. One question will be which cells express the majority of Calprotectin - invading neutrophils vs epithelium for example. The antibody list you provide is quite extensive. Which antibody would you recommend for our purpose? Which tissue would you recommend as positive control.

    A: Nine of our antibodies to Calprotectin have been validated for IHC-P with human tissue, and you can see all of these products. A number of our IHC images were generated using human spleen samples, and as such this may be a good choice of a positive control tissue. We do sell a human spleen slide product, which is suitable for IHC-P. Unfortunately I do not have an in-depth knowledge of Calprotectin, however the image shown for our antibody with catalogue number NBP1-02826 demonstrates clear staining of neutrophils. The following paper also suggests that the protein is abundant in neutrophils: PMID 11435495.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies
Loading...