SARS-CoV-2 ORF3a Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP3-15985
Loading...
Key Product Details
Species Reactivity
SARS-CoV-2
Applications
Western Blot, ELISA
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of coronavirus ORF3A (YP_009724391.1). GLEAPFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDC
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for SARS-CoV-2 ORF3a Antibody - Azide and BSA Free
Western Blot: SARS-CoV-2 ORF3a AntibodyAzide and BSA Free [NBP3-15985]
Western Blot: SARS-CoV-2 ORF3a Antibody [NBP3-15985] - Western blot analysis of extracts of 293T cells, using SARS-CoV-2 ORF3a antibody (NBP3-15985) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.Applications for SARS-CoV-2 ORF3a Antibody - Azide and BSA Free
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL.
Western Blot
1:2000 - 1:6000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: SARS-CoV-2 ORF3a
The SARS-CoV-2 ORF3a protein encodes for a Ca2+ ion channel that functions in NLRP3 (NOD-, LRR- and pyrin domain-containing protein 3) inflammasome activation (3, 4). The ORF3a ion channel also functions in viral particle release as well as apoptotic and necrotic cell death (5). SARS-CoV-2 ORF3a interacts with the inflammasome component TRAF3 (TNF Receptor Associated Factor 3) which activates ASC (apoptosis-associated speck-like protein contain CARD) ubiquitination and, in-turn, stimulates caspase-1 activation and IL-1beta (interleukin-1-beta) production and maturation (3, 4). IL-1beta activation results in cytokine production and the overproduction of cytokines referred to as a cytokine storm, a hallmark of COVID-19 (4). Additionally, high throughput screening experiments have revealed the SARS-CoV-2 ORF3a binds to the human heme oxygenase (HMOX1) protein (5). HMOX1 has a role in reducing inflammation and tissue damage, both features of SARS-CoV-2 infection (5). The ORF3a-HMOX1 interaction will be worth exploring for its role in innate immune response and as a potential therapeutic target for COVID-19 (5).
Alternative names for SARS-CoV-2 ORF3a includes 2019-nCoV ORF3a protein, COVID-19 ORF3a, Human coronavirus ORF3a protein, ORF3a protein, SARS-CoV-2 accessory protein 3a, SARS-CoV-2 protein 3a, SARS-CoV-2 protein U274, and SARS-CoV-2 protein X1.
References
1. Michel, C. J., Mayenr, C., Poch, O., & Thompson, J. D. (2020). Characterization of accessory genes in coronavirus genomes. Virology journal. https://doi.org/10.1186/s12985-020-01402-12. UniProt (P0DTC3)
3. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The protein journal. https://doi.org/10.1007/s10930-020-09901-4
4. Oladele, J. O., Ajayi, E. I., Oyeleke, O. M., Oladele, O. T., Olowookere, B. D., Adeniyi, B. M., Oyewole, O. I., & Oladiji, A. T. (2020). A systematic review on COVID-19 pandemic with special emphasis on curative potentials of Nigeria based medicinal plants. Heliyon. https://doi.org/10.1016/j.heliyon.2020.e04897
5. Batra, N., De Souza, C., Batra, J., Raetz, A. G., & Yu, A. M. (2020). The HMOX1 Pathway as a Promising Target for the Treatment and Prevention of SARS-CoV-2 of 2019 (COVID-19). International journal of molecular sciences. https://doi.org/10.3390/ijms21176412
Alternate Names
2019-nCoV ORF3a, 2019-nCoV ORF3a Protein, COVID-19 ORF3a, Human coronavirus ORF3a Protein, ORF3a protein, SARS-CoV-2, SARS-CoV-2 Accessory protein 3a, SARSCoV2 ORF3a Protein, SARS-CoV-2 ORF3a Protein, SARS-CoV-2 Protein 3a, SARS-CoV-2 Protein U274, SARS-CoV-2 Protein X1, Severe Acute Respiratory Syndrome Coronavirus 2
Gene Symbol
ORF3a
Additional SARS-CoV-2 ORF3a Products
Product Documents for SARS-CoV-2 ORF3a Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SARS-CoV-2 ORF3a Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCitations for SARS-CoV-2 ORF3a Antibody - Azide and BSA Free
Customer Reviews for SARS-CoV-2 ORF3a Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review SARS-CoV-2 ORF3a Antibody - Azide and BSA Free and earn rewards!
Have you used SARS-CoV-2 ORF3a Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...