SC35 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47290

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPR

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25800673)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SC35 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SC35 Antibody [NBP2-47290]

Immunocytochemistry/ Immunofluorescence: SC35 Antibody [NBP2-47290]

Immunocytochemistry/Immunofluorescence: SC35 Antibody [NBP2-47290] - Staining of human cell line U-251 MG shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290]

Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290]

Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290]

Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290]

Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290]

Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290]

Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290]

Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290]

Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290] - Staining of human tonsil shows moderate to strong positivity in germinal center cells.

Applications for SC35 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 1 using NBP2-47290 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SC35

SC35 is involved in pre-mRNA splicing and is found in the bodies in the nucleus referred to as speckles, SC 35 domains or splicing factor compartments (SFCs). The SC-35 clone is frequently used as a marker for these bodies, the role of which is controversial. Speckles correspond largely if not entirely to ultrastructures termed interchromatin granule clusters (IGCs). SC35 is excluded from the nucleolus.

Alternate Names

PR264, SC35, SC-35, serine/arginine-rich splicing factor 2, SFRS2, SFRS2A, splicing component, 35 kDa, splicing factor SC35, splicing factor, arginine/serine-rich 2, SR splicing factor 2, SRp30b

Gene Symbol

SRSF2

Additional SC35 Products

Product Documents for SC35 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SC35 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SC35 Antibody - BSA Free

Customer Reviews for SC35 Antibody - BSA Free (1)

1 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
100%

Have you used SC35 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • SC35 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Frozen
    Sample Tested: Liver
    Species: Mouse
    Verified Customer | Posted 12/20/2016
    This customer tested the product in an untested application (IHC-Fr) and earned the Innovator's Reward for this product. Antibody Storage Conditions: -20℃ Staining Expectations: positive signals should be within nucleus Fixative Composition: PFA Fixation Time & Temperature: 15 min RT Tissue Processing: as normal Blocking Solution: 5% goat serum in PBS Time & Temperature: 15min RT Primary Antibody: Dilution: 1:50 Diluent Buffer: 5% goat serum in PBS Time & Temperature: 15min RT Washing Conditions: Wash Buffer Composition: PBS Times/Washing: 5min x 3 times Repetitions: 3 Secondary Antibody Manufacturer and Catalog #: life technologies Ref:A11034 Secondary description: goat anti Rabit Dilution: 1:2000 Diluent Buffer: 5% goat serum in PBS Incubation Time & Temperature: 1 hour RT Post-Secondary Washing: PBS Detection Method: Detection: confocal Procedure: as olypus DAB-Incubation Time (if applicable): Click here to enter text. Controls: Positive Control: No Negative Control: no
    SC35 Antibody - BSA Free NBP2-47290

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...