Scaffold attachment factor B2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38086

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human Scaffold attachment factor B2 (NP_055464.1).

Sequence:
MAETLPGSGDSGPGTASLGPGVAETGTRRLSELRVIDLRAELKKRNLDTGGNKSVLMERLKKAVKEEGQDPDEIGIELEATSKKSAKRCVKGLKMEEEGTEDNGLEDDSRDGQEDMEASLENLQNMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEHAVDGEGFKNTLETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPFAQDTSSVGPDRKLAE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

107 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Scaffold attachment factor B2 Antibody - BSA Free

Scaffold attachment factor B2 Antibody

Western Blot: Scaffold attachment factor B2 Antibody [NBP3-38086] -

Western Blot: Scaffold attachment factor B2 Antibody [NBP3-38086] - Western blot analysis of various lysates using Scaffold attachment factor B2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for Scaffold attachment factor B2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Scaffold attachment factor B2

Scaffold attachment factor B2 (SAFB2) is a chromatin associated protein that interacts with DNA elements termed S/MARs (scaffold or matrix attachment regions) but is not part of the nuclear matrix. SAFB2 is structurally and functionally similar to SAFB1 and appears to be a multifunctional protein involved in chromatin organization, mRNA processing and transcriptional regulation. SAFB2 has been demonstrated to interact with and function as a corepressor with many nuclear receptors such as estrogen receptor-alpha, PPAR-gamma, and FXR-alpha.

Alternate Names

KIAA0138SAF-B2, scaffold attachment factor B2

Gene Symbol

SAFB2

Additional Scaffold attachment factor B2 Products

Product Documents for Scaffold attachment factor B2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Scaffold attachment factor B2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Scaffold attachment factor B2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Scaffold attachment factor B2 Antibody - BSA Free and earn rewards!

Have you used Scaffold attachment factor B2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...