SCFD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38582

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 373-642 of human SCFD1 (NP_057190.2).

Sequence:
SMLSDNTAKLTSAVSSLPELLEKKRLIDLHTNVATAVLEHIKARKLDVYFEYEEKIMSKTTLDKSLLDIISDPDAGTPEDKMRLFLIYYISTQQAPSEADLEQYKKALTDAGCNLNPLQYIKQWKAFTKMASAPASYGSTTTKPMGLLSRVMNTGSQFVMEGVKNLVLKQQNLPVTRILDNLMEMKSNPETDDYRYFDPKMLRGNDSSVPRNKNPFQEAIVFVVGGGNYIEYQNLVDYIKGKQGKHILYGCSELFNATQFIKQLSQLGQK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SCFD1 Antibody - BSA Free

SCFD1 Antibody

Immunohistochemistry: SCFD1 Antibody [NBP3-38582] -

Immunohistochemistry: SCFD1 Antibody [NBP3-38582] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using SCFD1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
SCFD1 Antibody

Western Blot: SCFD1 Antibody [NBP3-38582] -

Western Blot: SCFD1 Antibody [NBP3-38582] - Western blot analysis of various lysates using SCFD1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
SCFD1 Antibody

Immunohistochemistry: SCFD1 Antibody [NBP3-38582] -

Immunohistochemistry: SCFD1 Antibody [NBP3-38582] - Immunohistochemistry analysis of paraffin-embedded Rat lung using SCFD1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
SCFD1 Antibody

Immunohistochemistry: SCFD1 Antibody [NBP3-38582] -

Immunohistochemistry: SCFD1 Antibody [NBP3-38582] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using SCFD1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for SCFD1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SCFD1

SCFD1 (sec1 family domain containing 1) belongs to the STXBP-unc/SEC1 family of proteins. SEC1 proteins are involved in synaptic transmission and general secretion. SCFD1 is proposed to play a role in vesicular transport between the endoplasmic reticulum and the Golgi.

Alternate Names

C14orf163, KIAA0917chromosome 14 open reading frame 163, sec1 family domain containing 1, sec1 family domain-containing protein 1, SLY1, SLY1 homolog, Sly1p, STXBP1L2RA410, Syntaxin-binding protein 1-like 2, vesicle transport-related protein

Gene Symbol

SCFD1

Additional SCFD1 Products

Product Documents for SCFD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SCFD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SCFD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SCFD1 Antibody - BSA Free and earn rewards!

Have you used SCFD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...